(data stored in ACNUC30630 zone)

EMBL: CP000580.PE142

CP000580.PE142       Location/Qualifiers
FT   CDS_pept        150761..151744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95955"
FT                   /protein_id="ABN95955.1"
FT                   /translation="MTCRGLAEPGADKATARTVAVIVLILLAGVALRGRIPGAEPAADK
FT                   PTDAGPGSLIAVLVMLGLSMAVIAVSVVSQARHPVTRPATAADPPRFRGGEGAPFTWRM
FT                   VLVMVGALLVWLLVVLTLMRISGWLDVSVDQPAAPSPEPDPGSSSAADSEPPPPPPGSE
FT                   PPVSNAALGYFAAAAALFVLLSVIGAMAGRNARRRPTTVVATDDEGDDDAPSTSRTQSL
FT                   ARAAERGLIEIGDLSREPREAIIACYAAMERELGKSPGAMPQDSDTPTEVLARAVDRRL
FT                   LHGESATELVDLFEEARFSTHVMGEAHRDAAVRVLRLVLRELQDAA"
     gtgacctgcc gagggttagc cgagccgggt gccgacaagg cgacagcacg cacggtcgcg        60
     gtgatcgtgc tgatcctgct cgccggtgtc gcgttgcggg gccgcatccc cggtgccgaa       120
     cccgccgctg acaaacccac ggacgccggt ccgggatcac tcatcgccgt cctggtgatg       180
     ctcgggcttt cgatggcggt catcgccgtc tcggtggtca gccaggcgcg tcatcccgtc       240
     acccgcccgg ccaccgcggc ggatccgccc cgcttccgcg gcggcgaggg cgctccattc       300
     acgtggcgga tggtgctcgt gatggtcggc gccctgctgg tgtggctgct ggtggtgctg       360
     acactgatgc ggatcagcgg ctggctcgac gtgtccgtcg accaaccggc cgcgccgtcg       420
     ccggaaccgg atccgggttc gtcctcggcg gcggacagcg aaccgccacc accgccgccg       480
     ggttccgagc cgccggtctc caacgccgca ctgggctact tcgccgctgc cgcagcgctt       540
     ttcgtgttgc tgtcggtgat cggagcgatg gccggccgca acgcgcggcg ccgtcccacc       600
     acggtcgtcg ccaccgacga cgagggcgat gacgatgcgc cgtccacgag caggacgcag       660
     tcgctggccc gagcggccga acgcgggctg atcgagatcg gggacctcag ccgcgaaccg       720
     cgggaggcga tcatcgcgtg ctacgcggcg atggagcgcg aactcggaaa gtcgccgggc       780
     gccatgcccc aggactccga caccccgacg gaggtgctgg cccgcgccgt cgaccggcgc       840
     ctgctgcacg gtgagagcgc gaccgaactc gtcgacctct tcgaggaagc ccggttcagc       900
     acccacgtca tgggggaggc ccaccgcgac gccgcggtgc gggtgctgcg cctggtgctg       960
     cgcgaactgc aggacgcggc gtga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page