(data stored in ACNUC30630 zone)

EMBL: CP000580.PE153

CP000580.PE153       Location/Qualifiers
FT   CDS_pept        162504..162983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95966"
FT                   /protein_id="ABN95966.1"
FT                   /translation="MRSITLGRHRLGRSVCAAFAVTAAGGVAAAALTMPATPATAAPDP
FT                   CAASQVAKTVAAVATNTSNYLAANPETDQALTTIAQQQAGPASLASLKAYLDANPQVGS
FT                   DMQKLQQPLTNLSGRCKLPVTIPQVLGLMQAAQQSGAAQPAAPAAASPAAATGHR"
     atgcgatcga tcaccctggg ccggcaccgt ctgggccgaa gtgtctgcgc cgcgttcgcc        60
     gtcaccgccg ccggcggtgt cgccgccgcc gcgctgacca tgcccgcgac cccggcgacc       120
     gcggctccgg acccgtgcgc ggccagccag gtcgccaaga ccgtcgccgc cgtggccacc       180
     aacacctcca attacctggc ggccaacccc gagaccgatc aggcgctgac caccatcgcc       240
     cagcagcagg ccggaccggc ctcgctcgcc tcgctcaagg cgtatctcga cgccaacccc       300
     caggtcgggt cggatatgca gaagctgcag cagccgttga cgaacctgtc cgggcggtgc       360
     aagctgcccg tcaccatccc gcaggtgctg ggtctgatgc aggccgcgca gcagagcggc       420
     gctgcccagc ccgcggcgcc cgccgcggcg tcaccggccg ccgcgaccgg ccaccgatga       480
//

If you have problems or comments...

PBIL Back to PBIL home page