(data stored in ACNUC30630 zone)

EMBL: CP000580.PE155

CP000580.PE155       Location/Qualifiers
FT   CDS_pept        163526..164257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0155"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0165 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95968"
FT                   /protein_id="ABN95968.1"
FT                   /translation="MRGETGEPEPAAQDTPGRTVLMVDDDPDVRTSVARGLRHSGFDVR
FT                   VAANGKEALRLLSAESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTVNDR
FT                   IAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDRPSDTMTVGPLTIDTARRLVFVD
FT                   GERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLER
FT                   DGLPRVIHTVRGIGYVLRDEP"
     gtgcggggtg aaaccgggga gcccgaaccc gcagcgcagg acacccccgg tcgcacggtg        60
     ctgatggtcg acgacgaccc cgatgtccgc acgtccgtcg cgcgcggact gcggcattcg       120
     gggttcgacg tacgcgtcgc cgcgaacggt aaggaagcgc tacggctgct gtcggccgaa       180
     tcgcacgacg cgctggtgct cgacgtgcag atgccggaac tcgacggtgt cgccgtggtg       240
     accgcgctgc gagcgctcgg caacgacatc cccatctgcg tgctctcggc gcgcgacacc       300
     gtcaacgacc gcatcgccgg gctcgaggcg ggcgccgacg actacctcac caaaccgttc       360
     gacctcggtg agctggtggc ccggctgcat gcgctgctgc gccgggccca ccactccgac       420
     cgcccgtcgg acaccatgac ggtcgggccg ttgaccatcg acaccgcccg gcggctggtg       480
     ttcgtcgacg gagaacgggt ggatctgacc aaacgcgagt tcgacctgct cgccgtcctc       540
     gccgagaaca acggcgtggt gctgtcgcgc cagcggctgc tcgagctggt ctggggctac       600
     gacttcgacg tcgacaccaa cgtcgccgac gtgttcatct cctacctgcg gcgcaaactc       660
     gagcgcgacg gtctgccgcg ggtgatccac accgtgcgcg ggatcggata cgtgctgcgg       720
     gacgagccct ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page