(data stored in ACNUC30630 zone)

EMBL: CP000580.PE158

CP000580.PE158       Location/Qualifiers
FT   CDS_pept        complement(166030..167166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0158"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmc:Mmcs_0168 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95971"
FT                   /protein_id="ABN95971.1"
FT                   /translation="MSHDATANDAKRGRADPDGSTRGKYWWVRWAIITVAVVVLTVEVV
FT                   LVWDQLAKAWKSLVSANWWWVVAAVVASLASMHSFAQIQRTLLRSAGVHLKQWRSEAAY
FT                   YAGNALSTTMPGGPVLSATFLYRQQRLWGASPVVASWQLVMSGVLQGVGLALLGLGGAF
FT                   MLGASKNPLSLIFTLGGFAALLVLAQAVASRPELIDGIGARLLARFNSLRNKPLDTGLA
FT                   KWRELLRQLESVQLGRRDLSMAFGWSLFNWIADVACLAFACYAAGGHPSLAGLTVAYAA
FT                   ARAVGTIPLMPGGLLVVEAVLVPGLVSSGMTLASAISAMLIYRLVSWIFLAAIGWVVFF
FT                   FVFRTEKDIDPDAPVKGAHKAGEPIRNQPPRSAREDLA"
     gtgtcccacg acgcgacggc gaacgacgcc aagcgaggac gggccgaccc cgacggatcc        60
     acccgcggta agtactggtg ggtccgctgg gcgatcatca ccgtcgcggt cgtcgtgctc       120
     accgtcgaag tggtcctcgt gtgggatcag ctggcgaagg cctggaagag cctcgtctcc       180
     gcgaactggt ggtgggtggt cgccgccgtc gtcgcgtccc tggcctcgat gcacagcttc       240
     gcgcagatcc agcgcacgct actgcgctcg gccggggtgc acctgaagca gtggcgctcg       300
     gaggcggcgt attacgcggg caacgcgctg agcaccacga tgcccggtgg cccggtgctc       360
     tcggcgacgt tcctctaccg gcagcagcgg ctgtggggcg cgagcccggt ggtggcgtca       420
     tggcagctgg tgatgtccgg tgtgctgcag ggcgtcggcc tggcgttgct cggcctcggc       480
     ggtgcgttca tgctcggcgc gagcaagaac ccgctgtcgt tgatcttcac gctgggcggc       540
     ttcgccgcgc tgctcgtgct cgcgcaggca gtcgcgagcc gacccgagtt gatcgacggt       600
     atcggcgcac ggctgctggc ccggttcaac tcgctgcgca acaaacccct cgacacgggt       660
     ctggcgaagt ggcgggaact gctgcggcaa ctggagtcgg tgcagctggg ccggcgcgac       720
     ctcagcatgg cgttcgggtg gtcgctgttc aactggatcg ccgacgtcgc ctgcctggcg       780
     ttcgcctgtt acgccgcggg cggtcacccg tcgctggccg ggctcaccgt cgcctacgcc       840
     gccgcgcgtg cggtcggcac catccccctg atgccgggtg ggctgctggt cgtggaggcg       900
     gtgctcgtcc cgggtctggt gtcgagcggg atgacgctgg ccagcgcgat ctccgcgatg       960
     ctcatctacc ggctcgtcag ctggatcttc ctggccgcca tcggctgggt ggtgttcttc      1020
     ttcgtgttcc gcaccgagaa ggacatcgac cccgacgcgc ccgtgaaggg tgcgcacaag      1080
     gccggcgagc cgatccgcaa ccagccgccc cgttccgcgc gcgaggatct ggcgtga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page