(data stored in ACNUC30630 zone)

EMBL: CP000580.PE164

CP000580.PE164       Location/Qualifiers
FT   CDS_pept        174369..175862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95977"
FT                   /protein_id="ABN95977.1"
FT                   /translation="MSAASDPVAAADAVVAAVDPALDSPGVQSSDSVLVTGPWLAGVSS
FT                   LIAVLRDRLPEVSFVEADELPAGSAPVAVVFAVSAVSALAGSDCELLDLAADHTDCVIG
FT                   VVTKIDVHLDWREVMAADRELLGAHRRRYAALPWVGVAAAPDHGDPMVDDLVDLLRDTL
FT                   GDPAVLRRNRLRAWESQLEKVVARYRADGEGADRHARVSALRAQRDEIRRARRVEKSQR
FT                   AIALRSQIQQARVQLTYFARNRCASVRGELQEDIAELGRRRLDAFEQTVRGRAAEVMTE
FT                   VDEGVTTHLTAVAADLHLDDVPSPPQPIPVPDLPGPSLRSRRLETRLMMLLGAGFGLGV
FT                   ALAVSRLFSGVDPGLTVAGVLAGAAAGLAVAVWVVGIRGLLHDRGVLDRWVADVTATLR
FT                   SAAEEAVATRVLAAEAALTAALAAEEAADADAAAVRIAEIDAELREHAAATARAAALRD
FT                   RRLPGLQRALEAVCAELYDKKADEFTEANERNSGKNVGY"
     atgagcgccg cctccgatcc tgtcgccgcg gccgacgcgg tggtcgccgc cgtcgacccc        60
     gcgctggact cgccgggggt gcagtccagc gacagcgtgc tggtcaccgg tccgtggctg       120
     gccggggtca gcagcctgat cgcggtcctg cgggaccggc taccggaggt gtcgttcgtc       180
     gaggccgacg agctgcccgc gggcagcgca cccgtcgccg tggtgttcgc ggtctcggcg       240
     gtctccgcgc tggccggctc cgactgcgaa ctgctcgatc tggcggccga ccacaccgac       300
     tgcgtcatcg gcgtcgtcac caagatcgac gtgcacctcg actggcgtga ggtcatggcc       360
     gccgaccgcg aactgctcgg cgcgcaccgc cggcgctacg ccgcgctgcc gtgggtcggg       420
     gtggccgcgg cgcctgacca cggggacccg atggtcgacg acctggtgga cctgctgcgt       480
     gacaccctcg gcgatcccgc ggtgctgcga cgaaaccggt tgcgggcgtg ggaaagtcag       540
     ctcgagaagg tggtcgcgcg ctatcgcgcc gacggtgagg gcgccgacag gcacgcccgg       600
     gtgtccgccc tgcgcgcgca gcgcgacgag atccgccgcg ccagacgggt ggagaagtcg       660
     caacgcgcga tcgccctgcg gagccagata cagcaggcgc gcgtgcagtt gacgtacttc       720
     gcgcgcaacc ggtgcgcgtc ggtgcgcggc gaactgcagg aggacatcgc cgaactgggt       780
     cgccgcaggc tcgacgcctt cgaacagacg gtgcgcggcc gcgccgccga ggtgatgacc       840
     gaggtcgacg agggcgtcac cacccacctg accgccgtcg cggccgacct gcacctggac       900
     gacgtgccgt cacctccgca gccgattccc gtccccgacc tccccgggcc gtcgttgcgg       960
     tcgcgtcggc tcgagacgcg gctgatgatg ttgctcggcg ccggcttcgg actcggtgtc      1020
     gccctcgcgg tgagccggct gttcagcggg gtcgatccgg gcctgacggt cgccggtgtg      1080
     ctcgccggcg cggcggccgg gctggcggtg gcggtgtggg tggtcggcat ccgcgggttg      1140
     ctgcacgatc gcggtgtact ggaccgctgg gtcgccgacg tcaccgcgac gctgcgctcg      1200
     gcagccgaag aggccgtcgc cacccgcgtg ctggccgccg aggcggcgct gaccgccgcg      1260
     ctggccgccg aggaggcggc agacgcggac gccgcggccg tccggatcgc cgagatcgac      1320
     gccgaactgc gggagcacgc ggccgccacg gcgcgtgccg cggcgctgcg cgaccgtcgg      1380
     ttacccggct tgcagcgcgc gctggaggcg gtgtgcgccg agttgtacga caaaaaagca      1440
     gacgaattca ccgaggcgaa cgaacgcaat tccggaaaaa acgtcggcta ctga            1494
//

If you have problems or comments...

PBIL Back to PBIL home page