(data stored in ACNUC30630 zone)

EMBL: CP000580.PE175

CP000580.PE175       Location/Qualifiers
FT   CDS_pept        complement(187766..188638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0175"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   mmc:Mmcs_0186 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95988"
FT                   /protein_id="ABN95988.1"
FT                   /translation="MEWTATVAGIALIAVIVRDVFHTLFHPIGHGSIAPTVMKLIWRLL
FT                   GLLPPQRRIASLTGPLGIAMVVLAWGVIAVAGWTLIYWAQMPEGFAYGTELDPNERHDI
FT                   VDSLYLSLVTIGTLGFGDVVPTSVTLRLAAPIEALFGFMLLTAAVSWVLEIYPALHRRR
FT                   VLALQLSTLRRAREGDPVLPIDSVPVEVLTSLAAGIVEARNDFTQYSATYYFRDLETDA
FT                   SLAASLEYATQLAAEAMASAQDHVRTAGRLMKIAVDSLAELLDQEFLQLGGDTDAVVQA
FT                   YAVDHRHIN"
     atggagtgga cagccacggt ggccggcatc gcgctcatcg ccgtcatcgt gcgggacgtg        60
     ttccacacgc tgttccatcc gatcggccac ggcagtatcg cgccgacggt gatgaagctg       120
     atctggcggc tgctgggtct cctaccgcct cagcgccgga tcgcctcgct gaccgggccg       180
     ctcggcatcg ccatggtcgt gctcgcctgg ggtgtcatcg ccgtcgccgg ctggacgctc       240
     atctactggg cgcagatgcc cgagggtttc gcgtacggca cggagctgga tccgaatgag       300
     cggcacgaca tcgtcgactc gctgtacctg tcgctggtga ccatcggcac actcgggttc       360
     ggcgatgtcg taccgacgtc ggtgacgctg cggctggccg cccccatcga ggcgctcttc       420
     ggtttcatgc tgctcaccgc cgccgtgtcg tgggtgctcg agatctaccc ggcgctgcac       480
     cgccgccgcg tgctggcact gcagttgtcg acgctgcggc gggcgcggga gggcgatccc       540
     gtgctgccga tcgacagtgt ccccgtcgag gtcctcacct cgctggcggc gggcatcgtc       600
     gaagcgcgaa acgacttcac ccagtacagc gccacctact acttccgcga cctggaaacc       660
     gatgcgtccc tggcagcttc actggagtac gcgacccagc tcgccgccga ggcgatggcc       720
     agcgcacagg atcacgtccg gacggcgggg cggctgatga agatcgccgt cgacagcctc       780
     gccgaactgc tcgaccagga gttcctgcag ctcggcggtg acacggatgc cgtcgtacag       840
     gcctacgcgg tcgatcaccg gcacatcaac tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page