(data stored in ACNUC30630 zone)

EMBL: CP000580.PE189

CP000580.PE189       Location/Qualifiers
FT   CDS_pept        complement(201526..202431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0189"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0200 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96002"
FT                   /protein_id="ABN96002.1"
FT                   /translation="MPNTHIHAFHPDLRSVARYIPRQVITPVTLPVVRMVTRLQGKRTP
FT                   KDIEELTLSSGVRVRLFRPTGVPVPAPALLWIHGGGYVIGTAAQDDELCRRFCRELGIT
FT                   VASVDYRLAPEHPYPTPVEDCYDALTWMARLPAVDPKRVAIGGASAGGGLAASLALLTR
FT                   DRGEIEPVAQLLVYPMIDDRTVERQGLDHPGHRLWNQASNKFGWSAYLGDADPDVAVPA
FT                   RREDLAGLPPAWVGVGTLDLFHDEDLAYAERLRAAGVPCQVEVVQGAFHGFDGVLPKAD
FT                   VSRAFFRSQCDTLRQAFASG"
     atgccgaaca cgcacatcca cgcgttccac cccgacctgc gcagcgtcgc ccgctacatc        60
     ccgcgacagg tgatcacccc ggtgacgctg ccggtggtgc ggatggtgac gaggctgcag       120
     ggcaagcgca ccccgaagga catcgaggag ctcacgctgt cctcgggcgt gcgggtccgg       180
     ctgttccgcc cgaccggggt gccggtcccg gcgcccgcgc tgctgtggat ccacggcggc       240
     ggctacgtca tcggcacggc cgcacaggac gacgaactgt gccgacggtt ctgccgggaa       300
     ctcgggatca ccgtcgcctc ggtggattac cggctggcgc ccgaacaccc ctaccccacc       360
     ccggtcgagg actgctacga cgcgttgacg tggatggccc ggctgccggc ggtggacccg       420
     aagcgggtgg cgatcggcgg ggccagcgca ggcggcgggc tggccgcctc actggccctg       480
     ctcacccgcg accgcggtga gatcgagccg gtggcacagc ttttggtgta tccgatgatc       540
     gacgaccgca ccgtcgagcg ccagggcctg gaccaccccg gccaccggct gtggaaccag       600
     gccagcaaca agttcggctg gtcggcctat ctcggtgacg ccgatcccga cgtcgcggtg       660
     cccgcccgcc gggaggatct ggcgggcctg ccgcccgcgt gggtgggtgt cggcaccctg       720
     gacctgttcc acgacgagga tctggcgtac gccgagcggt tgcgggccgc cggcgtgccg       780
     tgccaggtcg aggtggtcca gggtgccttc cacggattcg acggagtcct gccgaaggcc       840
     gacgtgtcgc gggcgttctt ccgaagccag tgcgacaccc tccggcaggc cttcgcctcc       900
     ggttag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page