(data stored in ACNUC30630 zone)

EMBL: CP000580.PE196

CP000580.PE196       Location/Qualifiers
FT   CDS_pept        210308..211255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0196"
FT                   /product="pentapeptide repeat containing protein"
FT                   /note="PFAM: pentapeptide repeat containing protein; KEGG:
FT                   mmc:Mmcs_0207 pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96009"
FT                   /protein_id="ABN96009.1"
FT                   /translation="MKVSARSYLIAGVSLASAGLIVGGSNTPVLDTTRADITVAPMAAT
FT                   TTAPQLDGPGVGGAASAFGSVGAAFVAPAPAPDVTARIALPEVDGLDPEAGRPGVQLSL
FT                   LTGTPNLGYGNEGLFNAGVNNDGDFNIGGDNDGDFNIGTGNVGDFNIGYDNDGDFNIGG
FT                   DNEGNFNVGFDNRGGERNFGAGNTGSYNVGFFNTGEFNFGVGNTGVGNVGFFNTGDYTV
FT                   GAFNVGIRYAGNPGISTGRTVADTEDEDPGTSALRTRAAQSEDDNDDDAAVTRSEKNDD
FT                   ASTSDSTSTDKAGDTRAAKASDDKGDGNEGGDDE"
     atgaaggtct cagctcgttc gtatctcatc gccggcgttt ccctcgcgag cgcgggcctg        60
     atcgtcggcg ggtccaacac acccgtcctc gacaccaccc gggccgacat caccgtcgct       120
     ccgatggcgg ccaccaccac cgccccacag ctggacgggc ccggggtggg cggcgccgcg       180
     tcggcattcg ggtcggtcgg ggcggcgttc gtggcgccgg cgcccgcacc ggacgtgacc       240
     gcgcggatcg cgttgcccga ggtcgacgga ctggacccgg aggcaggccg gccgggcgtc       300
     cagctcagcc tgctcaccgg cacccccaac ctcggttacg gcaacgaggg gctgttcaac       360
     gccggggtga acaacgacgg tgacttcaac atcggcggcg acaacgacgg cgacttcaac       420
     atcggcaccg gcaacgtcgg cgatttcaac atcggttacg acaacgacgg tgacttcaac       480
     atcggcggcg acaacgaggg caacttcaac gtcggattcg acaaccgcgg cggtgagcgc       540
     aacttcggtg cgggcaacac cggttcctac aacgtcgggt tcttcaacac cggagagttc       600
     aacttcgggg tcggcaacac cggcgtcggc aacgtcggct tcttcaacac cggcgactac       660
     accgtcggcg ccttcaacgt cgggatccgg tacgcaggca atccggggat cagcaccggg       720
     cgcaccgtcg cggacaccga ggacgaggat ccgggcacca gcgcactgcg gacccgtgcc       780
     gcccagagcg aggacgacaa cgacgacgac gcggcggtca cgcggtcgga gaagaacgac       840
     gacgcttcga cttccgacag cacctcgacc gacaaggcgg gtgacacacg cgctgccaag       900
     gcgtccgacg acaaaggtga cggcaacgag ggcggcgacg acgaatag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page