(data stored in ACNUC30630 zone)

EMBL: CP000580.PE199

CP000580.PE199       Location/Qualifiers
FT   CDS_pept        complement(212176..213006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0199"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   mmc:Mmcs_0210 protein of unknown function DUF1206"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96012"
FT                   /protein_id="ABN96012.1"
FT                   /translation="MTDETGAAGAVRTATNHRGAQVAARVGYLINGILHLLIAYIIFRI
FT                   AIGSGHNDADQSGALAALAQTKGGFLALWGVAIALVPLTLWRLAETILGLHPSEHHDPD
FT                   PDPDDFLMVNRLKALGLAVVYAAVAAMAVQFALGSRHSSAERSVGLSIWLMRTPEGKAV
FT                   LAVIGLGVTAVGCYFAFKGASRRFRDDLNISGGRVLTVLGASGHVAEGLVLAVAGVLVV
FT                   VASVRADPSKATGLDGAVKALGQMPFGSVLIGVAAAGFAAYGLYSFALTRYARM"
     gtgacagatg agaccggcgc cgccggtgcg gttcgcaccg ccacgaacca ccggggggca        60
     caggttgcgg cacgcgtcgg ctatctgatc aacggcatcc tgcacctgct gatcgcctac       120
     atcatcttcc gtatcgcgat cggctccgga cacaacgacg cggaccagtc gggtgcgctg       180
     gccgcgctcg cccagaccaa gggcggattc ctcgcgctgt ggggagtcgc gatagcgctg       240
     gtgccgttga cgctgtggcg gctggccgag acgatcctcg gcctgcatcc cagcgagcac       300
     cacgatccag atccggatcc cgacgacttc ctgatggtca accggctcaa ggcgctcggg       360
     cttgcggtgg tctacgccgc ggtggcggcg atggccgtcc agttcgccct cggcagccgc       420
     cattccagcg cggagcggtc ggtggggctg agcatctggt tgatgcgcac tccggagggt       480
     aaggcggtgc tcgcggtcat cggcctcggc gtcacggcgg tgggctgtta cttcgcgttc       540
     aagggggcct cgcggcggtt ccgcgacgac ctcaacatct ccggcgggcg tgtgctcacg       600
     gtcctcgggg cgtcgggaca cgtcgcggag ggcctggtcc tcgcggtcgc cggggtgctg       660
     gttgtcgtcg catcggtgcg ggccgatccg tcgaaggcca ccggactcga cggcgcggtc       720
     aaggcgctcg ggcagatgcc gttcggttcg gtgctgatcg gggtggccgc ggcgggtttc       780
     gccgcctacg gtctgtacag cttcgcgctc acccgctacg cgcggatgtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page