(data stored in ACNUC30630 zone)

EMBL: CP000580.PE200

CP000580.PE200       Location/Qualifiers
FT   CDS_pept        complement(213022..213216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0200"
FT                   /product="CsbD family protein"
FT                   /note="KEGG: art:Arth_3578 CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96013"
FT                   /protein_id="ABN96013.1"
FT                   /translation="MGVGDKARNKMQQIQGRMRATTGSAINDPGMRARGRGDERMAHLK
FT                   GAGEKLKDAFRSRRRPRGY"
     atgggcgtcg gcgacaaggc gaggaacaag atgcagcaaa tccagggccg gatgcgtgcg        60
     acgacgggca gcgcgatcaa cgaccccggc atgcgggcgc ggggccgcgg cgacgagcgg       120
     atggctcacc tcaagggcgc cggggagaag ctgaaggacg ccttccggtc ccgtcgccgg       180
     ccgcgcggct actga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page