(data stored in ACNUC30630 zone)

EMBL: CP000580.PE205

CP000580.PE205       Location/Qualifiers
FT   CDS_pept        217365..217898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0205"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="KEGG: mmc:Mmcs_0215 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96018"
FT                   /protein_id="ABN96018.1"
FT                   /translation="MATVYYTASSLDGYIVDADDSLDWLISRDIDPDGPFHYDAFVDQV
FT                   GALVMGAATYEWIVKNQPGEWMYSQPTWVVTHRPDIVAAGHPVHTFAGDVTELHPELVA
FT                   AAGGKDVWVVGGGELAAQFVAASLVDEMIVSYAPCTLGAGSPVLPIRSEWELVESAVNR
FT                   EFVCARWRVAALTG"
     atggcgaccg tgtactacac cgcgtcgagc ctggacggtt acatcgtcga cgccgacgac        60
     agcctggact ggctgatctc ccgcgacatc gaccccgacg gaccgttcca ctacgacgcg       120
     ttcgtcgacc aggtgggcgc gctggtgatg ggcgcggcca cctacgagtg gatcgtgaaa       180
     aaccaaccgg gagaatggat gtactcccag ccgacctggg tggtgacgca ccggccggac       240
     atcgtcgccg ccggccaccc cgtgcacacc ttcgcaggcg acgtgaccga actgcatccg       300
     gagctggtgg ccgcggccgg cggcaaggat gtgtgggtgg tcggcggagg ggagctggcc       360
     gcgcagttcg tggccgcgag tctggtcgac gagatgatcg tgagctacgc cccgtgcacg       420
     ctcggcgctg gttcgcccgt tctgccgatc cgctcggagt gggagctggt cgagtcggcc       480
     gtcaaccgcg aattcgtctg tgcgcgttgg cgcgtggccg cgctcactgg gtga             534
//

If you have problems or comments...

PBIL Back to PBIL home page