(data stored in ACNUC30630 zone)

EMBL: CP000580.PE206

CP000580.PE206       Location/Qualifiers
FT   CDS_pept        complement(217888..218505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0206"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3661c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96019"
FT                   /protein_id="ABN96019.1"
FT                   /translation="MTRTSTKRGSTRTNMLIGAAEVLRERGAAGVTIDEVLQRSGAPRG
FT                   SVYYHFPEGRSQIVAEALEYAGESITSLIDEAAANGGRYLVEHFVDFWDRVLAESDFTA
FT                   GCPVVAAAIGSAEDGPQLTSVAGAIFGHWREALTRAFEVDGCEPSEAASLAITSIAALE
FT                   GAVVLCRATRDLDPLRQVHTQLEFLLKSREFIRRNGVPTVTQ"
     atgaccagga cttccacgaa gcgcgggtcg acgcgcacca acatgctcat cggcgcggcc        60
     gaggtgctcc gcgagcgcgg cgccgccggg gtcaccatcg acgaagtgct ccagcgcagc       120
     ggcgcaccgc gcggcagcgt ctactaccac ttccccgagg gtcgcagtca gatcgtcgcc       180
     gaggcgctgg agtacgccgg ggagtcgatc acctcgctga tcgacgaggc cgccgccaac       240
     ggcggtcgct acctggtgga gcacttcgtc gacttctggg accgcgtgct ggccgagagc       300
     gacttcaccg cgggctgtcc ggtggtcgcc gcggcgatcg gctccgccga ggacggaccc       360
     caactcacct cggtggccgg ggcgatcttc gggcactggc gtgaggcgct cacgcgcgcc       420
     ttcgaggtcg acgggtgcga gccgagcgag gccgcctcgc tggcgatcac gtccatcgcc       480
     gcactggagg gcgccgtggt gctgtgccgg gccacccggg acctcgaccc gctgcggcag       540
     gtgcacaccc aactcgaatt cctgttgaag tcgcgggagt tcatccgccg caacggagtc       600
     cccaccgtca cccagtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page