(data stored in ACNUC30630 zone)

EMBL: CP000580.PE218

CP000580.PE218       Location/Qualifiers
FT   CDS_pept        complement(235111..235626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0218"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0228 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96031"
FT                   /protein_id="ABN96031.1"
FT                   /translation="MTAHADVSARESVSEVHRQVGQEIMVIAYDGTANARRAVHYAGRF
FT                   LSANRAVVLTVWSPTLRGSEPPAVDLDGPPDPAPDDEDIAYADAQRTNAEGIELARAAG
FT                   LSAEAMCVAATSTVWNTIIETADTLDADLIVTGTRGTTGLRSLLQSSVADRVLRHGHRP
FT                   VLIVPPGR"
     atgaccgccc acgccgacgt ctcggcccgg gagtcagtct cagaggtcca ccggcaggtc        60
     ggccaggaga tcatggtgat cgcctacgac ggcaccgcca acgcccgtcg tgcggtgcac       120
     tatgcgggac ggttcctgtc cgcgaaccgc gcggtggtgc tcacggtgtg gtcgcccacg       180
     ctgcgcggat cggagccacc cgcggtggat ctcgacggtc cgccggatcc ggcgcccgac       240
     gacgaggaca tcgcctacgc cgacgcccag cgcaccaacg ccgagggaat cgagttggcc       300
     cgggccgccg gcctgtccgc cgaggcgatg tgcgtggccg cgaccagcac cgtgtggaac       360
     accatcatcg agaccgcgga cacgttggac gcggatctga tcgtcaccgg aacccgcggc       420
     accaccgggc tgcgctcttt gctgcagtcc agcgtcgccg accgggtgct gcgtcacggg       480
     caccggccgg tgctcatcgt gccgccgggc cgctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page