(data stored in ACNUC30630 zone)

EMBL: CP000580.PE226

CP000580.PE226       Location/Qualifiers
FT   CDS_pept        244265..244921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0226"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0236
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96039"
FT                   /protein_id="ABN96039.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLDRELGRFVDEVRSKIDFSQGARDLLRNAVLSFLTYIDTNR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIELVSRLLREGTRHPEPDTDFEMMAVALVGAG
FT                   EAIATRVSTGDADVDEAAELMINLFWRGLKGTPSDAAGQERSDSGMSKGAAVASN"
     atggccggag gaaccaagcg tttgccacgc gcggtgcgtg agcagcagat gctcgacgcg        60
     gccgtgcaga tgttctcggt gaacggctat cacgagacct cgatggacgc gatcgccgcc       120
     gaggcgcaga tctccaagcc gatgctctac ctgtactacg gctccaaaga ggacctgttc       180
     ggtgcttgtc tggaccgtga gctcggccgg ttcgtcgacg aggtgcgcag caagatcgac       240
     ttcagccagg gtgcgcgtga cctgctgcgc aacgcggtgc tgtcgttcct gacctacatc       300
     gacaccaacc gcgcctcgtg gatggtgctc tacacccagg cgaccagttc gcaggccttc       360
     gcccacaccg tgcgcgaagg tcgtgagcgg atcatcgaac tggtcagccg gcttttgcgc       420
     gagggcaccc ggcaccccga accggacacc gacttcgaga tgatggccgt ggcgctcgtc       480
     ggcgcgggtg aggcgatcgc cacccgcgtc agcaccggcg acgccgatgt cgacgaggcc       540
     gccgagctga tgatcaacct gttctggcgc ggtctgaagg gcaccccgtc cgacgccgcc       600
     ggccaggagc gcagcgactc ggggatgtcc aagggcgccg ccgtcgcgtc gaactag          657
//

If you have problems or comments...

PBIL Back to PBIL home page