(data stored in ACNUC30630 zone)

EMBL: CP000580.PE229

CP000580.PE229       Location/Qualifiers
FT   CDS_pept        complement(246532..247377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0229"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmc:Mmcs_0239 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96042"
FT                   /protein_id="ABN96042.1"
FT                   /translation="MGGQPSGTRNLLRAAAGALPFVPRGESLPERTLTVDELAIDPANV
FT                   AAYADVTGLQFGDTVPLTYPFALTFPTVMALVTGFDFPFAAMGSVHIENHITQYRPIAV
FT                   SDTVSAAVHAENLREHRRGLLVDVVTDVEVGNELAWHQVTTFLHQQRTSLSDQPKPPPQ
FT                   KPPKLGPPNALLNITAGQIRQYASVGGDHNPIHTNPIAAKLFGFPTVIAHGMFSAAAVL
FT                   ANIEGQLPGAVEYSVRFAKPVVLPAKAGLYVERTADGGWDLTLRNSKGDPHLTGTVRGL
FT                   "
     atgggcggac aacccagcgg aacccgaaac ctgttgcgcg cggcggccgg tgcgctgccg        60
     ttcgtccccc gcggtgagtc gctgcccgag cgaacgctca ccgtcgacga gttggcgatc       120
     gaccccgcca acgtcgccgc atacgccgat gtgacggggt tgcagttcgg cgacaccgta       180
     ccgctgacgt acccgttcgc gttgaccttc ccgaccgtga tggcgttggt gaccggattc       240
     gacttcccgt tcgccgcaat gggttcggtg cacatcgaga accacatcac ccagtatcgg       300
     cccatcgcgg tcagcgatac ggtatccgcc gcggtgcacg ccgagaacct gcgtgagcac       360
     cgccgcggtc tgctggtcga cgtggtgacc gacgtcgagg tcgggaacga actggcatgg       420
     catcaggtga cgacgtttct gcaccagcag cggacgagcc tgtccgatca gcccaagccg       480
     ccgccgcaga agccgccgaa actcggcccg ccgaacgcgt tgttgaacat caccgccggg       540
     cagatccgcc agtacgcctc ggtcggcggc gaccacaacc cgatccacac caatcccatt       600
     gcggccaaac tgttcggctt cccgacggtg atcgcccacg ggatgttctc ggcggcggcg       660
     gtcctggcca acatcgaggg gcagctgccc ggcgcggtcg agtactcggt gcgcttcgcc       720
     aaaccggtcg tcctgcccgc caaggcggga ctgtacgtcg agcgcaccgc cgacggcggc       780
     tgggatctca ccctgcggaa cagcaagggt gacccacacc tgacgggcac cgtccgcggg       840
     ctgtag                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page