(data stored in ACNUC30630 zone)

EMBL: CP000580.PE241

CP000580.PE241       Location/Qualifiers
FT   CDS_pept        complement(276925..277086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96054"
FT                   /protein_id="ABN96054.1"
FT                   /translation="MTLSHTHSLNDIRTAIRELSTRADLARKEGRPSDAAEIERRIQGY
FT                   REELAQRP"
     atgaccctca gtcacacgca cagcctcaac gacatccgaa cggcgatccg ggagttgtcc        60
     acgcgcgccg acctggcccg caaggagggc cggcccagcg atgccgccga gatcgagcgg       120
     cggatccagg gttatcgcga ggaactcgcc cagcgcccct ag                          162
//

If you have problems or comments...

PBIL Back to PBIL home page