(data stored in ACNUC30630 zone)

EMBL: CP000580.PE244

CP000580.PE244       Location/Qualifiers
FT   CDS_pept        complement(279885..280703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0244"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mmc:Mmcs_0254 putative succinate dehydrogenase
FT                   (membrane anchor subunit) (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96057"
FT                   /protein_id="ABN96057.1"
FT                   /translation="MSAPTADREGTGVYSAGRAKIPQRTLRTDRWWVPSLLTNLGLAAF
FT                   VVYATIRAFWGSAYWVADYHYLTPFYSPCVSKGCIPEASHFGQILPDVWWLPYAAFSLP
FT                   FLLLFRLTCYYYRKAYYRSVWQSPPGCAVAEPHSTYTGETKLPLIMQNLHRYFFYVAVL
FT                   ISLINTWDAILAFHSPSGFGFGLGNVILVVNVVLLWTYTISCHSCRHVTGGRLKHFSKH
FT                   PVRYWMWTQISKLNTRHMQFAWITLGTLVLTDFYVMLVASGTISDLRFIG"
     gtgagcgcac cgaccgcaga ccgcgagggc accggcgtct actccgccgg ccgcgccaag        60
     atcccgcagc ggaccttgcg caccgaccgt tggtgggtgc cgtcgctgtt gaccaacctc       120
     ggcctggccg cgttcgtcgt ctacgcgacg atccgggcgt tctggggcag cgcctactgg       180
     gtggccgact accactacct gacgccgttc tactcaccgt gtgtcagcaa gggctgcatc       240
     ccggaggcca gccacttcgg ccagattctg cccgacgtct ggtggcttcc gtacgcggcg       300
     ttctcgctgc cgttcctgct gctgttccgg ctgacctgtt actactaccg caaggcctac       360
     taccgctcgg tgtggcagtc gcccccggga tgcgctgtgg ccgaaccgca ttcgacctac       420
     accggtgaga ccaagctgcc gctcatcatg cagaacctgc accgctactt cttctacgtc       480
     gccgtgctca tctcgctgat caacacctgg gacgcgatcc tggcgttcca ctcccccagc       540
     ggattcggct tcggactcgg caacgtcatc ctcgtcgtca acgtggtgct gttgtggacc       600
     tacacgatct cctgccactc ctgccggcac gtcaccggcg gccgcctcaa gcacttctcc       660
     aaacacccgg tccggtactg gatgtggact cagatcagca agctcaacac caggcacatg       720
     cagttcgcgt ggatcacgct gggcaccctg gtgctgaccg acttctacgt catgctggtc       780
     gccagcggca ccatctccga cctgagattc attggctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page