(data stored in ACNUC30630 zone)

EMBL: CP000580.PE245

CP000580.PE245       Location/Qualifiers
FT   CDS_pept        complement(280801..281157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96058"
FT                   /protein_id="ABN96058.1"
FT                   /translation="MWLASVAYCDSRHPSAQGGHLSTTTGFAELHELIGGLRRCVTALA
FT                   SQYGDSPAMRRIVNDAERILNDIDRLDIDAEELELGRGLSRHHHVGEKIPIPDTQYDTE
FT                   FWRGVDDEGLGGTH"
     atgtggctag catcggttgc gtactgtgat tcacgacacc cttcagccca aggaggtcac        60
     ttgtccacca cgaccggttt cgccgaactg cacgaactca tcggcggcct gcgacgctgc       120
     gtcaccgcgc tggcgtccca gtacggcgac tccccggcga tgcgccgcat cgtcaacgat       180
     gccgaacgca tcctcaacga catcgaccgt ctcgacatcg atgccgagga actcgaactc       240
     ggccgcgggt tgagcagaca tcaccacgtc ggcgagaaga tcccgatccc cgacacccag       300
     tacgacaccg aattctggcg cggtgtcgac gacgagggcc tcggcggcac ccactga          357
//

If you have problems or comments...

PBIL Back to PBIL home page