(data stored in ACNUC30630 zone)

EMBL: CP000580.PE260

CP000580.PE260       Location/Qualifiers
FT   CDS_pept        complement(294429..295394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0260"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmc:Mmcs_0270 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96073"
FT                   /protein_id="ABN96073.1"
FT                   /translation="MSTAWSRRNFLAMTATLAGSTVLAGCGGDAPGTVAKDGSVTVTHA
FT                   FGETRIPGPPTRVVSAGLTEQDDLLAVEVVPIAVTDWFGGEPFGVWPWARGQLGPAQPT
FT                   VLSLGDGIQIEAIRALNPDLIVATNAGLDADTYTTLSEIAPTVAQSGSAAFFEPWKDQA
FT                   TIIGQAVFKADEMAALIARVDEKFTNAASANPQFGGKKALLLRGPLYRDSVQAVRPGWR
FT                   TDFLTQMGFTVADPGDPLIPRDRMASVLDAADVLIWTTESEQEQGALLADPTIAGLKAV
FT                   AGGRTIFTDKELAGAIAFASPLSYPLVADRLPPLLAQILA"
     gtgtcaactg cctggtcgcg gcgcaacttc ctggccatga ccgccacgct cgccggttcg        60
     acggtgctcg ccggctgcgg gggcgacgcg cccggcaccg tcgcgaagga cggctccgtc       120
     accgtcacgc acgccttcgg cgagacccgc atccccgggc cgcccacccg cgtcgtcagc       180
     gccggactca ccgaacagga cgacctgctg gccgtcgagg tcgtgccgat cgccgtcacc       240
     gactggttcg gcggtgagcc gttcggcgta tggccatggg cgcgaggcca actcgggccc       300
     gctcagccga cggtgctcag cctcggcgac ggtatccaga tcgaggcgat ccgcgcgctg       360
     aaccccgacc tgatcgtcgc caccaacgcc ggcctggacg ccgacaccta cacgacgctg       420
     tcggagatcg cgccgacggt ggcgcagagc gggtccgccg cattcttcga gccgtggaag       480
     gaccaggcca cgatcatcgg ccaggcggtg ttcaaggccg acgagatggc ggcgctgatc       540
     gcccgcgtcg acgagaaatt caccaacgcg gcctcggcca atccacagtt cggcggaaag       600
     aaggcgctgc tgctgcgcgg cccgctctac cgcgacagcg tccaggccgt acgcccgggt       660
     tggcgcaccg acttcctcac ccagatgggc ttcaccgtcg ccgaccccgg cgatccgctg       720
     atcccccgcg accggatggc gtcggtgctc gacgccgccg acgtcctcat ctggacgacc       780
     gagagcgaac aggaacaggg cgcgctgctc gccgatccga ccatcgcggg tctgaaagcc       840
     gtcgcgggtg ggcgcaccat cttcaccgac aaggaactcg ccggggcgat cgcgttcgcc       900
     tccccgctgt cctatccgct ggtcgccgac cggctgccgc cgctgctcgc gcagatcctg       960
     gcctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page