(data stored in ACNUC30630 zone)

EMBL: CP000580.PE263

CP000580.PE263       Location/Qualifiers
FT   CDS_pept        complement(297797..298396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0263"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mmc:Mmcs_0272 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96076"
FT                   /protein_id="ABN96076.1"
FT                   /translation="MTYPVVLGFLSALTLIAAIGAQNAFVLRQGIRGEHVAAVVALCTV
FT                   SDVLLIGAGIAGFGALVTAHPAALDIARFGGAAFLIGYGLLAARRAARPAALTPSEQGP
FT                   ARLVGVLVTCAALTWLNPHVYLDTVVLLGALANEHREDRWLFGVGAVTASAVWFTALGF
FT                   GARRLGGLFSAPSTWRVLDALIAMIMIALGVAVALG"
     gtgacctacc ccgtcgtcct cggctttctg tcggcgctca cgctgatcgc cgccatcggc        60
     gcgcagaacg cattcgtcct gcgccagggc atccgtggtg aacacgtcgc cgccgtcgtc       120
     gcgttgtgca cggtgtccga cgtcctgttg atcggcgccg gcatcgccgg cttcggcgcg       180
     ctcgtcaccg cccaccccgc agcgctggac atcgcacggt tcggtggcgc cgcgttcctg       240
     atcggctatg gactgttggc cgcccggcgc gccgcgcgac cggccgcact cacgccatcg       300
     gagcagggcc cggcccgcct cgtcggggtg ctcgtcacat gcgcggcact gacgtggctc       360
     aacccccacg tctatctcga cacggtcgtg ctgctcggcg ccctggccaa cgagcaccgc       420
     gaggaccgct ggctcttcgg tgtcggcgcc gtcacggcga gcgccgtctg gttcaccgct       480
     ctgggcttcg gcgcgcgccg cctcggcggc ctgttctcgg caccgtcgac gtggcgggtt       540
     ctcgacgcgc tgatcgcaat gatcatgatc gctctcggcg tcgccgtcgc gctcggatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page