(data stored in ACNUC30630 zone)

EMBL: CP000580.PE266

CP000580.PE266       Location/Qualifiers
FT   CDS_pept        300306..301493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0266"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0275 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96079"
FT                   /protein_id="ABN96079.1"
FT                   /translation="MKSISARNVAGTLAVVCIAAIVALAVGLFNGSFTRSATVTVVSDR
FT                   VGLVMNPDTKVKLHGAQVGKVAAIEALPDGRAAIRLAMDPSQLAIIPSNVLVNVGSTTV
FT                   FGSKAVELVPPANPSPDPLRAGQVLDAGHVTVEINTVFEQLVSVLAKVEPAKLNETLGA
FT                   LSQGLAGRGEKFGRTLVDLDTLLADLDPSMDNLSRDIAVAPGVLNAYADAAPDLLATAD
FT                   NASRISDTLVERQSDLDALLVSAIGLAEVGNDVVATNRGAFTDVMRLLVPTTDLTNQYH
FT                   TALNCGLAGMLPLAMAPPPPVPGVLLLDSFVLGTERYRYPQNLPKVAARGGPQCVGLPD
FT                   VGYETRAPYVVSDIDANPAQYGNQGILLNSEGLKQMLFGPLDGPPRNTSQIGQPG"
     atgaagtcga tctccgcgcg caacgtggcg ggcacgctgg ccgtggtgtg catcgccgcg        60
     atcgtcgcgt tggcggtcgg actgttcaac gggtcgttca cgagaagtgc gacggtgacc       120
     gtcgtctccg accgcgtcgg gttggtgatg aaccccgata ccaaggtgaa actgcacggg       180
     gcgcaggtcg gcaaggtcgc cgcgatcgag gcgctgccgg acggccgggc cgccatccgg       240
     ctcgcgatgg atccttccca actggcgatc atcccgtcca acgtcctggt caatgtcggg       300
     tcgacgacgg tattcggttc caaggcagtg gaattggtgc cgccggccaa cccctcaccg       360
     gacccgttgc gcgccggtca ggtgctcgac gccggacacg tgaccgtgga gatcaacacg       420
     gtgttcgagc aactcgtgtc cgtcctggcg aaggtggaac ccgccaagct caacgagacg       480
     ctgggcgcgt tgtcccaggg cctcgccgga cggggcgaga agttcggccg aacgctggtc       540
     gacctcgaca ccctgctcgc cgacctcgac cccagcatgg acaacctcag ccgcgacatc       600
     gccgtcgccc caggggttct caacgcctac gccgacgctg ctcccgatct gctcgccacg       660
     gccgacaatg cgtcgcggat cagtgacacg ctggtggaac ggcagagcga cctcgatgct       720
     ctgctggtca gcgccatcgg gctcgccgag gtcggcaacg acgtcgtggc gacgaaccgc       780
     ggcgcgttca ccgacgtcat gcggctgctg gtgcccacga cggatctgac caaccagtac       840
     cacaccgcac tgaattgcgg tctggccggg atgctgccgt tggccatggc gccgccacca       900
     ccggttcccg gtgtgctgct gctggattcg ttcgtcctgg gtaccgagcg ctaccggtac       960
     ccccagaacc tgccgaaggt ggcggcgcgc ggcggaccgc agtgtgtggg cctgcccgac      1020
     gtgggctatg agacccgcgc gccgtacgtc gtctccgaca tcgacgccaa cccggcgcag      1080
     tacggcaacc agggcatcct gctcaactcc gaagggctca agcagatgct gttcggaccc      1140
     ctcgacggac cgccgcgcaa cacctcgcag atcggccagc cgggatga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page