(data stored in ACNUC30630 zone)

EMBL: CP000580.PE271

CP000580.PE271       Location/Qualifiers
FT   CDS_pept        306145..307683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0271"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0280 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96084"
FT                   /protein_id="ABN96084.1"
FT                   /translation="MLTRFVRTQLIIFTVTAVVAMGVMIFGYLQAPTLLGIGRMTVTVE
FT                   LPGTGGLYRFSNVTYRGVEVGKVTDVRATRQGAVATLSLGTNQDIPADLHAAVRSVSAV
FT                   GEQYVDLQPRTGSAPYLHDGSVIGVENTSIPQAVGPMLDEVSAMIDSIPKDKISGLLDE
FT                   SAKALNGSAYDLGSMLDSSATVVGDAKGVSGEMRSLIDDSGPLLEGQAQTADQLRTWAR
FT                   SLAGVTGQVAANDPQVRTLLGTGPGAADEASRLLNAVKPTLPVLLANLTTIGQVAVTYH
FT                   ASIEQLLVLLPPYVAATQTVGVSRNNPTGMSLGDFTLNLNDPPACTVGFLPPSSWRSPD
FT                   DESDIDTPDGLYCKLPQDSPIGVRGARNYPCMGQPGKRAATAEQCASDKPFEPLAMRQH
FT                   VLGPYPFDPSLVAQGIPPDDRVDSDEQLYGPVGGTPMPPPSPEPAPAPGGPAVAPSAFT
FT                   PGESGGPSVAIATYDPQTGKYATPDGKVFTQPALGSKDAGGQNKTWQDLLPTGA"
     atgctcaccc gtttcgtgcg tacccagctg atcatcttca cggtcaccgc tgtggtggcg        60
     atgggtgtga tgatcttcgg gtacctgcag gctcccaccc tgctcgggat cggccggatg       120
     acggtgaccg tcgaactgcc gggcaccggt ggcctctacc ggttttcgaa cgtgacctac       180
     cgcggtgtcg aggtcgggaa ggtcaccgac gtgcgcgcca cccggcaggg cgccgtggcc       240
     acgctgtcgc tcggcacgaa ccaggacatc cccgccgacc tgcacgccgc tgtgcgcagt       300
     gtgtcggcgg tcggtgagca gtacgtcgat ctgcagccgc gcaccggatc cgctccgtat       360
     ctgcacgacg gttcggtcat cggtgtggag aacacgtcga tcccgcaggc ggtcgggccg       420
     atgctcgacg aggtgagcgc gatgatcgac agcattccca aggacaagat cagcggcctg       480
     ctcgacgaat cggcgaaggc cctcaacggc tccgcatacg atctcggatc gatgctcgac       540
     tcgtcggcga cggtggtcgg ggacgccaag ggcgtcagcg gcgagatgcg ttcactcatc       600
     gacgacagcg ggccactgct cgagggtcag gcgcagaccg ccgatcagct ccgcacctgg       660
     gcccgcagcc tggccggtgt caccggtcag gtggccgcga acgacccaca ggtccgcacg       720
     ctgctgggca caggtcccgg tgctgccgac gaggcgtcgc ggctgctcaa cgccgtcaaa       780
     ccgacgctgc cggtgcttct ggccaacctc accaccatcg gtcaggtcgc ggtcacctac       840
     cacgcatcga tcgaacagct cctcgtactg cttccgccgt atgtggccgc gacgcagacg       900
     gtgggcgtct cgcggaacaa cccgacggga atgtcgttgg gcgacttcac cctcaacctc       960
     aacgatccgc ccgcgtgcac cgtggggttc ctgcccccgt cgtcgtggcg ctcacccgac      1020
     gacgagagcg acatcgacac ccccgacggc ctgtactgca aactgccgca ggactccccg      1080
     atcggggtgc gcggggcccg caactacccg tgcatgggtc agccgggcaa gcgggcggcc      1140
     accgccgaac agtgcgccag cgacaaaccg ttcgagcccc tggccatgcg tcagcacgtg      1200
     ctgggtccct acccgttcga tccctccctt gtcgcgcagg ggatcccgcc ggacgatcgc      1260
     gtcgactccg acgagcagct ctacggtccg gtcggcggca cgcccatgcc gccgccgagt      1320
     cccgagccgg caccggcgcc cggtggcccg gccgtcgcgc cgagcgcatt cacccccggt      1380
     gagtccggtg gtccttcggt ggcgatcgcc acctacgatc cgcagaccgg gaaatacgcc      1440
     acacccgacg gcaaggtgtt cacgcagcct gcgctcggct cgaaagatgc cggcgggcag      1500
     aacaagacat ggcaggacct gctgccgaca ggggcctga                             1539
//

If you have problems or comments...

PBIL Back to PBIL home page