(data stored in ACNUC30630 zone)

EMBL: CP000580.PE281

CP000580.PE281       Location/Qualifiers
FT   CDS_pept        314430..314852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96094"
FT                   /protein_id="ABN96094.1"
FT                   /translation="MLGAVLALAAVLSPPAAHAETPYGNFEMQIQGRYDFHTWLWAVSR
FT                   CPGECLRVQAIAQPVAKAFAFRADAHLVDGRYTMTVDVPDGLRCGNVYYGPVIPTRDVY
FT                   TWDDATRSGTLSSSFATGCDGAPGGTLTYPFRLVRL"
     gtgctgggtg cggtgttggc gttggcggcg gtgctgtcgc cgccggcggc gcacgccgag        60
     acgccgtacg gcaacttcga gatgcagatc cagggcaggt acgacttcca cacctggctg       120
     tgggcggtgt cgcggtgccc gggtgagtgt ctacgggtgc aggcgatcgc gcagcccgtc       180
     gccaaggcgt tcgcgttccg ggcggatgcc cacctggtcg acgggcgcta caccatgacc       240
     gtcgacgtgc ccgacggatt gcgttgcggc aacgtctact acggtccggt gatccccacc       300
     cgtgacgtgt acacctggga cgacgccacc cggtcgggaa cgctgtcctc gtctttcgcc       360
     accggatgtg acggcgcgcc cggtgggacc ctgacctacc cgttccggct ggttcgcctg       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page