(data stored in ACNUC30630 zone)

EMBL: CP000580.PE282

CP000580.PE282       Location/Qualifiers
FT   CDS_pept        314863..315714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0282"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0291
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96095"
FT                   /protein_id="ABN96095.1"
FT                   /translation="MRIGVSTPVVVQVPGVAAEWERDAGIEDLRTVAQAADSLGFEYLT
FT                   CSEHVAVPAADALARGAVYWDPLATLGFLAACTSRIRLATSVIVLGYHHPLEIAKRYGT
FT                   LDRVSGGRLTLGVGVGSLAAEFELLGAQFGDRGRRADDALRALRASLSTTRPAYDGEFY
FT                   QYASVVVEPCAAQPRVPIWVGGRTRRSLRRAVELADGWMPFGLSADRLSELLSTVDVPA
FT                   DFDIVLPVAPLDPSGDRDRAARRLRALDDLGATAVTCTLAATSAGHYCDQLEALRAIAD
FT                   DL"
     atgcgaatcg gtgtgtccac gccagtggtc gtccaggtgc ccggggtggc cgcggagtgg        60
     gagcgggacg ccgggatcga ggacctgcgg acggtcgccc aggcggcgga ttccctcggc       120
     ttcgagtacc tgacctgctc cgagcatgtc gccgtgcccg ccgccgacgc gctggcccgc       180
     ggcgccgtgt actgggatcc gctcgccacg ctgggcttcc tggccgcgtg tacgtcacgc       240
     atccggctgg cgacgtcggt gatcgtgctc ggctaccacc acccgctgga gatcgccaag       300
     cggtacggca ccctcgaccg ggtcagcggc ggccggttga cactgggcgt cggcgtggga       360
     tccctggccg cggaattcga gctcctcggc gcgcagttcg gtgaccgcgg ccgccgcgcc       420
     gacgacgcgc tgcgcgcgct ccgcgcctcc ctgtcgacga ctcgaccggc ctacgacggc       480
     gagttctacc aatacgcttc cgtggtggtc gaaccgtgcg cggcgcagcc gcgggtgccc       540
     atctgggtcg gtggacgcac ccggcgatca ctgcgccggg cagtggaatt ggccgacggc       600
     tggatgccct tcgggctgtc ggccgatcgg ctctcggagc tgttgtcgac ggtggacgtc       660
     ccggccgact tcgacatcgt cctgccggtc gcgccgctcg acccctccgg ggaccgggat       720
     cgggccgcgc ggcggctgcg cgcactcgac gatctcgggg cgacggcggt cacgtgcaca       780
     ctcgcggcga cctccgccgg tcactattgc gatcagctcg aggcgctgcg cgccatcgcc       840
     gacgacctct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page