(data stored in ACNUC30630 zone)

EMBL: CP000580.PE293

CP000580.PE293       Location/Qualifiers
FT   CDS_pept        complement(325402..326991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0293"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0302 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96106"
FT                   /protein_id="ABN96106.1"
FT                   /translation="MNYDVIVVGFGAAGAAAAIEAADRGARVLVLDRGYGGGATALSGG
FT                   IVYAGGGTAEQQAGGYHDSVEDMRAYLESEVGDSVSGETLDRFCRQSPAMIEWLKAQGV
FT                   EFRGGEVPTYKTSYPTDDFYLYYSGNEKAYPYAGRARPVPRGHRVLARGMSSGKVLFDR
FT                   LARSAKHKGVEFIPLAQVHSLIQDDDGRIAGVRYRALDPAHPNARRHKVLTKLTGKAGT
FT                   WMPGLVEGLVARAEEMRTGASLDAEARAPAVILAAGGFVHNREWMQAHAPQFMKVSPLG
FT                   TVGDDGTGIALGLAAGGVTGKMDNVTAWRFLSPPSAFLEGLTVGADGRRIANEDLYGAT
FT                   HGNVLMRDFGGTGWAIYDAQTWRKVKSQIRTQTQIFQRLQLIYLFTIGHKKAASIEDLA
FT                   AENGIDAEGLRRTVDEYHRGLDNGAGDPAHKDPELCPPLLTPPFYSIDISADSSMFFPI
FT                   PGLTLGGLLVDESTGEILGADGESVPGLYAAGRNAVGVCSNSYVSGLSLADCIFSGRRA
FT                   GAHAAGGLGQPR"
     atgaactacg acgtcatcgt cgtcggattc ggcgcagccg gtgcggcagc cgcgatcgag        60
     gccgccgacc ggggcgcacg cgtgctcgtg ctcgaccgcg gttacggcgg cggtgcgacg       120
     gcgttgtccg gcgggatcgt ctacgccggt ggcggcaccg ccgaacagca ggccggcggc       180
     taccacgaca gcgtcgagga catgcgggcc tacctcgagt ccgaagtcgg cgactccgtg       240
     tccggcgaga cactggaccg gttctgccgg cagagcccgg cgatgatcga gtggctcaag       300
     gcgcagggcg tcgagttccg cggcggcgag gtgcccacct acaagacctc gtatccgacc       360
     gacgacttct acctgtacta ctccggcaac gagaaggcct atccgtacgc aggccgcgcc       420
     cggccggtac cgcgcggcca ccgcgtcctc gcgcgcggaa tgagttccgg caaggtcctg       480
     ttcgaccgcc tcgcccgatc ggcgaaacac aagggcgtgg aattcatccc cctggcccag       540
     gtgcacagcc tcatccagga tgacgacggc cgcatcgccg gtgtccgcta ccgcgcgttg       600
     gatccggcgc acccgaacgc gcgcaggcac aaggtattga ccaagctcac cgggaaggcg       660
     ggcacctgga tgcccggact ggtcgagggc ctcgtcgcgc gtgcggagga gatgcgcacc       720
     ggtgcttccc tggacgcgga ggcccgcgca cccgcggtga tcctcgcggc gggaggcttc       780
     gtccacaacc gagagtggat gcaggcccac gcaccgcagt tcatgaaggt ctccccgctg       840
     ggaaccgtcg gcgacgacgg caccggcata gcgctggggc tcgccgccgg cggggtgacc       900
     ggcaagatgg acaatgtgac ggcctggcga ttcctctcgc cgccgagcgc gttcctcgag       960
     gggctcaccg tcggggcgga cggacggcgc atcgccaacg aggacctcta cggcgccacc      1020
     catggcaacg tgctgatgcg tgacttcggt ggcaccggat gggcgatcta cgacgcgcag      1080
     acgtggcgga aggtgaaaag ccagatccgc acccagaccc agatcttcca acgcctgcag      1140
     ctgatctacc tgttcacgat cggccacaag aaggccgcct cgatcgagga cctcgccgcc      1200
     gagaacggga tcgacgccga aggccttcga cgcacggtcg acgagtacca ccgcggcctc      1260
     gacaatggtg ccggggatcc cgcacacaag gaccccgaac tctgtccgcc gctgctcacc      1320
     ccgccgttct actcgatcga catctcggcc gactcctcga tgttcttccc gattcccggc      1380
     ctgaccctcg gcggcctgct ggtcgacgag agcaccggcg aaatactggg tgccgacggg      1440
     gaatcggtgc cgggtctgta cgccgccgga cgcaacgcgg tgggcgtgtg ctccaacagc      1500
     tacgtcagcg ggctgtccct cgccgactgc atcttcagcg gtcggcgcgc gggcgcgcac      1560
     gccgcgggcg gattgggaca gccacggtga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page