(data stored in ACNUC30630 zone)

EMBL: CP000580.PE303

CP000580.PE303       Location/Qualifiers
FT   CDS_pept        complement(337017..337637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0303"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmc:Mmcs_0312 stress responsive alpha-beta
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96116"
FT                   /protein_id="ABN96116.1"
FT                   /translation="MYSVIRLLDVDESERDDVLDTLRRSTFGAERTLVEPTLPGVRNGG
FT                   DILVRLRFSDRHARVDAVTKLDELLDRNAVRHVNGATYSGSSTPGADGIATVYRALLLR
FT                   VRPGTDEATVRRFEDDLRLLPRYVRTIHSWQLSRVEDAIGTSTWTHVFEQEFTDVDGLM
FT                   GPYLMHPIHWAYVDRWFDPECPDMIVRDRVCHSFCRNDAVVHA"
     atgtatagcg tcatccgcct gctcgacgtg gacgagtcgg agcgcgacga cgttctggac        60
     acgttgcgcc gaagcacctt cggcgccgag cggacgctcg tcgaaccgac gctgcccggg       120
     gtacgcaatg gcggcgacat cctcgtgcgg ttgcggttct ccgaccggca cgcgcgtgtc       180
     gacgccgtga cgaagctcga cgaactgctg gaccgcaatg ccgtccggca cgtcaacggc       240
     gccacctaca gcggctcatc cacccccggc gccgacggga tcgccaccgt ctatcgggca       300
     ttgctgctgc gcgtacgtcc cgggaccgat gaggcgaccg tccgccgatt cgaggacgat       360
     ttgcggctac tcccccgcta cgtgcggacc atccactcgt ggcagctgag ccgggtcgag       420
     gacgccatcg gtacgtcgac gtggacgcac gtgttcgagc aggagttcac cgatgtcgac       480
     gggttgatgg gcccgtacct catgcatccg attcactggg cgtacgtcga ccggtggttc       540
     gatccggagt gtccggacat gatcgtgcgg gatcgggtgt gccacagctt ctgccgcaac       600
     gacgcggtgg tgcacgcctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page