(data stored in ACNUC30630 zone)

EMBL: CP000580.PE305

CP000580.PE305       Location/Qualifiers
FT   CDS_pept        complement(337964..338896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0305"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0314 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96118"
FT                   /protein_id="ABN96118.1"
FT                   /translation="MTGALDPQIADLIERLDRGFPPVQTMTGAQARATIRSRFIAPAEP
FT                   EPVAAVEDRSVGEIPIRIYHPAGAGPLPVLVYAHGGGFVFCDLDSHDGLCRDIANQTAA
FT                   IVVSVDYRLAPEHPWPAAAEDVYAVTRWVADNCTALGADPGRIAVGGDSAGGNLAAVTA
FT                   LIARDRGGPSLVAQLLVYPMVTPDFTTESYRLFGSGYYNPAEALRWYWDQYVPNDFDRT
FT                   HPYVSPLHADLSGLPPAVVVIAGHDPLRDEGVRFGEALSAAGVPTVVRCFDGGIHGFMT
FT                   MPSLELAQTARAQLCQDAVALLTGVPAGG"
     atgaccgggg cgctcgaccc gcagatcgcc gacctcatcg agaggctgga ccgcggcttc        60
     ccaccggtgc agaccatgac cggcgcgcag gcacgggcca cgatccgctc ccggttcatc       120
     gcccccgccg aacccgagcc ggtcgccgcg gtcgaggacc gcagcgtggg tgagatcccg       180
     atacggattt accatcccgc cggtgccgga cccctgcccg tcctggtcta cgcccacggc       240
     ggcggtttcg tgttctgcga cctcgacagt cacgacgggc tgtgccgcga cattgccaat       300
     cagactgccg ccatcgtcgt ttcggtcgac taccgactgg ctcccgagca tccgtggccg       360
     gccgcggccg aggacgtgta cgcggtcacg cggtgggtgg cggacaactg caccgcactg       420
     ggcgccgatc ccggacgtat cgcggtcggc ggtgacagcg ccggaggcaa tctggccgcg       480
     gtcaccgccc tgatcgcccg ggaccgcggc gggccttcgc tggtcgccca gttgctcgtc       540
     tacccgatgg tcacccccga tttcaccacc gagtcgtacc ggttgttcgg gtccgggtac       600
     tacaacccgg ccgaggcgct gcggtggtac tgggatcagt acgtacccaa cgacttcgac       660
     cgcacgcacc cctatgtgtc gccgctgcac gccgatctga gcgggctgcc gcctgctgtc       720
     gtggtgatcg ccggccacga tccgctccgg gacgagggtg tgcgattcgg tgaggcgctg       780
     tccgcggccg gggtgcccac ggtggtgcgc tgtttcgacg gtggcatcca cggcttcatg       840
     accatgccga gcctcgaact cgcgcagacc gcccgcgcgc agctgtgcca ggatgccgtc       900
     gctctgctga cgggagttcc cgccggtggc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page