(data stored in ACNUC30630 zone)

EMBL: CP000580.PE313

CP000580.PE313       Location/Qualifiers
FT   CDS_pept        complement(347297..347902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0313"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0324
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96126"
FT                   /protein_id="ABN96126.1"
FT                   /translation="MDSTITAVTRRDRVVAAALHLAADGYDAVHIRTVAELAGVAPSTV
FT                   YQHFASKDDLLVASLHRWLSACETDARAPLDRIAEPYDRLLYVADFITQRLWAEPLLAD
FT                   ALTRAYLCAESVAAANADRVRNSLSQMLTSAMGRELPTVRHQHIGDLVADIWASSMLAV
FT                   AQHRATADGSRERLARTIAVIARHDAEEGLPSAGLRAV"
     gtggacagca cgatcacggc cgtgacccgt cgagacaggg tcgtcgcagc tgccttgcat        60
     ctggccgccg acggttacga cgccgtgcac atccggacgg tcgccgaact ggccggtgtc       120
     gcgccgagca ccgtctacca gcacttcgcc tcgaaggacg acctgctggt cgcctcgttg       180
     caccggtggc tctcggcgtg tgagaccgac gcccgggcgc cgttggacag gatcgccgag       240
     ccgtatgacc ggctgctgta cgtcgccgac ttcatcaccc aacgactctg ggccgaaccg       300
     cttctcgccg atgccctcac ccgcgcgtac ctgtgcgcgg agagtgtcgc ggcggccaac       360
     gccgatcggg tgcgcaacag cctgagtcag atgctcacgt cggcgatggg ccgcgaactc       420
     ccgacggtcc gtcatcagca catcggtgac ctggtcgccg acatctgggc gtcgtccatg       480
     ctggcggtgg cccagcaccg cgccacggcc gacggttcgc gggagcggct ggccaggacc       540
     atcgcggtga tcgcccgaca cgatgccgag gaaggcctcc ccagcgccgg ccttcgggca       600
     gtctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page