(data stored in ACNUC30630 zone)

EMBL: CP000580.PE325

CP000580.PE325       Location/Qualifiers
FT   CDS_pept        357946..358554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0325"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0336
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96138"
FT                   /protein_id="ABN96138.1"
FT                   /translation="MGEPRDRSDDRLLAVVVEILDNDGYDAVQLREVARRARVSLSTIY
FT                   KRYATRDELILAALEAWMEDNRYSGVVPHPKAADASLHEALMDLFRTIFEPWEQHPGML
FT                   TAYYRARSSPSGQTLLQRGLDVVVPAGLELLADVDDSFIDDLNAVVSSVVYGLLGRFST
FT                   GEIAITEILPTLDRAVYWLTTGYEAAKGSVVAVHTRDVR"
     atgggcgaac cgagggaccg gagtgatgac cggttgctcg ccgtcgtggt ggagatcctc        60
     gacaacgacg gatacgacgc agtgcaactg cgggaagtcg cgcgccgggc ccgcgtctcg       120
     ttgagcacga tctacaagcg ctatgccacc cgcgacgagt tgatcctcgc cgcgctggag       180
     gcatggatgg aggacaaccg gtactccggg gtcgtcccac atcccaaggc ggcggacgcc       240
     tcgctccacg aagcgttgat ggacctgttc cgcaccatct tcgaaccgtg ggaacagcac       300
     ccgggcatgc tgacggcgta ctaccgcgcg cggtcatcgc cgagtgggca gaccttgttg       360
     cagcgcggcc tcgatgtcgt ggttccggcc ggcctcgagt tgctcgccga tgtcgacgac       420
     tcgttcatcg acgacctcaa cgccgtcgtg tcgagcgtgg tgtacgggct gctgggtcgc       480
     ttctccaccg gggagatcgc gatcaccgag atactcccga cgctcgaccg tgccgtgtac       540
     tggctgacga cgggttacga agcggcgaaa ggctcagtgg ttgccgtaca tacgcgcgat       600
     gtccggtga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page