(data stored in ACNUC30630 zone)

EMBL: CP000580.PE327

CP000580.PE327       Location/Qualifiers
FT   CDS_pept        359257..360729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0327"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mmc:Mmcs_0170 protein of unknown function
FT                   DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96140"
FT                   /protein_id="ABN96140.1"
FT                   /translation="MCARKSSPRFDFLAHARELIETSFVTVVRWSLRGGVLFMLRTSVR
FT                   SMDGLSGAVDHLVASIAAMQTASIDDLSHEQIVAELDRIKAAVWAVPSVEHRLTARLMD
FT                   ADPHALGATSLKRLLADRLRISDKTAGERLADARQLGPRHTLTGERVQTELAHTADAVA
FT                   RGDIGTAHVRIIQDFVKKLPVWVSWDRREGYERDLVGHAVALRPEDFRKVADTLLGFID
FT                   QDGTEPDHHTHQRRREFTVGRQQADGMSRVQGWLTPEARAYWDVIAAKYAAPGASVPHD
FT                   DAVTGCDDRTTGQRHHDALTRALRHTVESGSLGQVAGVPAAIVATTTVNELERAAGWAH
FT                   TGGGNRLPVQDLIRMAAESRHYLAVFDDHTEEILYFGRAKRCATTAQRLALFARDKGCT
FT                   HPQCTVPFYWTEVHHTHDYSQGGRTDITDLTLACQPANLLIEKTGWTTQRPGNGRTQWI
FT                   PPTDQDTGQPRINHHFHPQRYLTDKADDDEPE"
     gtgtgcgcgc gaaagtcatc gccgcgcttc gatttcttgg cgcacgctcg cgaactaatc        60
     gaaacctcgt tcgtcacagt ggttcggtgg tcactccgcg gcggtgtttt gttcatgctt       120
     cgaactagtg ttcgaagcat ggatggattg tctggcgcgg tcgaccacct cgtggcgtcc       180
     atcgccgcta tgcaaaccgc ttccatcgac gacctgtccc acgagcagat cgtggccgaa       240
     ctggaccgca tcaaagcagc ggtgtgggcg gtccccagcg tggagcaccg cctgaccgcg       300
     cggctgatgg acgccgaccc gcacgcgttg ggggcgacgt cgttgaagag gctgctcgcc       360
     gaccggctcc gcatctccga caaaaccgcc ggcgagcggc tggccgacgc gcgccagttg       420
     gggccgcgcc acaccctgac cggggagcgg gtgcagaccg agttggccca caccgcggat       480
     gcggtcgccc gcggcgacat cggcaccgcc cacgtgcgca tcatccagga cttcgtcaag       540
     aagctgccgg tgtgggtgtc ctgggaccgt cgcgagggct acgaacgcga cctcgtcggt       600
     catgcggtgg cgttgcggcc cgaggacttc cgcaaggtcg ccgacaccct gctggggttc       660
     atcgatcagg acggcaccga acccgaccac cacacccacc aacgccgccg cgagttcacc       720
     gtcgggcgcc agcaggccga cgggatgagc cgcgttcagg gctggctcac ccccgaagcc       780
     cgcgcctact gggatgtcat cgccgccaaa tacgccgccc ccggcgccag cgtgccccac       840
     gacgacgcgg tcaccggctg cgacgaccgc accaccggac aacgccacca cgacgcgctc       900
     acccgcgccc tgcgccacac cgtcgaatcc ggctccctcg gccaggtcgc cggggtgccg       960
     gcggccatcg tggccaccac caccgtcaac gagttggagc gcgccgccgg gtgggcgcac      1020
     accggcggcg gcaaccgcct accggtccaa gatttgatcc ggatggccgc cgagtcgcgg      1080
     cactacctgg cggtcttcga cgaccacacc gaagaaatcc tgtatttcgg ccgggcgaaa      1140
     cgctgcgcca ccaccgccca acggttggcg ttgttcgccc gcgacaaggg ctgcacccac      1200
     ccccagtgca ccgtgccgtt ctactggacc gaagtccacc acacccacga ctactcccag      1260
     ggtgggcgca ccgacatcac cgacctcacc ctggcctgtc aacccgccaa cctgctcatc      1320
     gagaagaccg ggtggaccac ccagcggccc ggcaacggcc gcacccaatg gatcccaccc      1380
     accgaccagg acaccggcca accccgcatc aaccaccact tccacccgca gcgctacctc      1440
     accgacaagg cagacgacga cgaacccgaa taa                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page