(data stored in ACNUC30630 zone)

EMBL: CP000580.PE328

CP000580.PE328       Location/Qualifiers
FT   CDS_pept        complement(360766..361431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0328"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0339 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96141"
FT                   /protein_id="ABN96141.1"
FT                   /translation="MPLATTRRAGLVDQVIAQLRASVSAGEWPVGTRIPTEPALVAALG
FT                   VGRNTVREAVRALAHSGILEVRQGDGTYVRATSEVSGAVRRLCGSELREVLEVRRCLEV
FT                   EGARLAATVRTAEDLAEIRALLARRDALDARDEFVRADAEFHFAVVRASHNAVLTELYR
FT                   GLTEVVTASVATTVETHAFDRIPHDGLVEAIAAGDVDRAGHEAGGFLEELIEELPDRR"
     gtgccgctcg ccactacccg ccgcgcaggc ctggtggacc aggtgatcgc tcaattgcgc        60
     gcgtcggtgt ccgccggcga gtggccggtc ggcacccgga tcccgacgga gcccgcgctg       120
     gtcgccgctc tcggcgtcgg ccgcaacacc gtccgggaag cggtgcgcgc gctggcccac       180
     agcggaatcc tggaggtccg acagggcgac ggcacatatg tgcgggccac gagcgaggtc       240
     tccggggcag tgcgccggct gtgcggttcg gagttgcgcg aggtgctgga ggtgcggcgt       300
     tgcctcgagg tcgaaggtgc ccggttggcg gcgaccgtgc gcaccgccga agatctcgcc       360
     gagattcgcg cgttgctcgc ccgccgggat gccctcgacg cccgtgacga gttcgtgcgg       420
     gccgacgcgg aattccactt cgcggtggtg agggcgtcgc acaacgcggt gctgaccgag       480
     ttgtaccgcg ggctcaccga agtggtcact gcgagtgtgg cgaccaccgt ggaaacccac       540
     gccttcgacc ggatcccaca cgacgggttg gtcgaagcga tcgcagcagg cgatgtcgac       600
     cgagccggcc acgaggcagg cggtttcctc gaggagctca tcgaggaact accggatcga       660
     cgctga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page