(data stored in ACNUC30630 zone)

EMBL: CP000580.PE33

CP000580.PE33        Location/Qualifiers
FT   CDS_pept        38039..38446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95846"
FT                   /protein_id="ABN95846.1"
FT                   /translation="MTDRDDIADVLIRYATGIDRRDWPLFRTVFTDDCALDYGDIGTFD
FT                   GVDAVTEFMDQAHAMAGHTLHRLTNFAIDVDGDSARARAYVDALIFAPDNASGVNAVGF
FT                   YDDELVRTPAGWRIARRRFTTVRVSPVGGQS"
     atgaccgacc gcgacgacat cgccgacgtc ctgatccgct acgccaccgg catcgaccgc        60
     cgcgactggc cgctgttccg gaccgtgttc accgacgact gcgccctcga ctacggcgac       120
     atcggcacct tcgacggcgt cgacgcggtc accgagttca tggaccaggc gcacgcgatg       180
     gccggtcaca ccctgcaccg gctgacgaac ttcgccatcg acgtcgacgg tgacagcgcc       240
     cgcgcccgcg cgtacgtcga cgcactgatc ttcgccccgg acaacgcttc cggcgtgaac       300
     gccgtcgggt tctacgacga cgaactggtc cggaccccgg ccgggtggcg catcgcgcgg       360
     cgccggttca ccaccgtccg ggtcagcccc gtcggaggac agtcgtga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page