(data stored in ACNUC30630 zone)

EMBL: CP000580.PE335

CP000580.PE335       Location/Qualifiers
FT   CDS_pept        complement(366926..369196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0335"
FT                   /product="trehalose synthase"
FT                   /note="TIGRFAM: trehalose synthase; PFAM: alpha amylase,
FT                   catalytic region; KEGG: mmc:Mmcs_0346 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96148"
FT                   /protein_id="ABN96148.1"
FT                   /translation="MSEAPETDYDDQAGSGTDDQTNEPSEITYDEYLHPARPRALRFRP
FT                   RVKSPFTRRSVAQDGPARADNPAYVSWLLSQSMLADANEISQQFSGQGSMWQNPYATPS
FT                   PRGAVETASVWFTAYPLSLITRPNESFLKALADDEMWKAFADIGIEAIHTGPVKRAGGI
FT                   SGWQTTPSVDGHFDRISTEIDPAFGTEEEFRKMCGTANWYGGTIIDDIVPGHTGKGADF
FT                   RLAEMKYADYPGIYHMVEVDPRDWEHLPAVPPGVDSVNIDQATEEWLDKAGYIIGRLQR
FT                   VIFYAEGIKETNWSVTRPVLGVDGVERRWVYLHYFKDGQPSINWLDPSFAGMRLVIGDA
FT                   LHSLADLGTGGLRLDANGFLGAEKTAAEDSTAWSEGHPLSEAANHLIASMVRKVGGFTF
FT                   QELNLTIDDIRQIGEAGADLSYDFINRPAYQHALATADTEFLRLTLRTTLELGVDPASL
FT                   IHALQNHDELTYELVHWSNGHRDDIYTYKGEEITGEALGETIRRDLSVRLTGENAPYNL
FT                   VFTTNGIACTTATVIAATLGITDLNEIDDDPVRIDRIRRAHLLLAMFNALQPGVFALSG
FT                   WDLCGMLTLPAGQVGELLRGGDTRWIHRAAHDLMGVNPAATQSLAGMPRGRSLYGSIPD
FT                   QLDDETSFLRQLQAILRVRSHYGIATSRQVDIPEVSHRGMLVLVHQLADEGRYQLTVLN
FT                   FANEEVAGTVRSEALPPGAEVSDMFTGHAFATVDDLHSFTVEMPAHHGMSLLVEVTADD
FT                   SET"
     atgtctgagg cgccagagac ggactacgac gaccaggccg ggtcgggcac cgacgatcag        60
     acgaacgagc ccagcgagat cacctacgac gagtacctgc atccggcgcg tccgcgggcg       120
     ctgcggttcc gtccccgcgt caaatcgccg ttcacccgcc gctcggtggc ccaggacggt       180
     ccggcgcgcg cggacaaccc ggcgtacgtg tcgtggctgc tgtcgcagtc gatgctcgcc       240
     gacgccaacg agatcagcca gcagttctcc ggtcagggct cgatgtggca gaacccgtac       300
     gcgacaccga gcccgcgcgg cgcggtggag acggcgtcgg tgtggttcac cgcctacccg       360
     ttgtcgttga tcacccggcc caacgagtcg ttcctcaagg cgctggccga cgacgagatg       420
     tggaaggcgt tcgccgacat cggtatcgag gccatccaca ccggaccggt caagcgcgcg       480
     ggcgggatct cggggtggca gaccaccccg agcgtcgacg gccacttcga ccgcatcagc       540
     accgagatcg acccggcctt cggcaccgag gaggagttcc gcaagatgtg cgggacggcc       600
     aactggtacg gcggcacgat catcgacgac atcgtgcccg gccacaccgg taagggcgcc       660
     gacttccgcc tcgcggagat gaagtacgcc gactatcccg ggatctacca catggtggag       720
     gtggatcccc gcgactggga acacctgccc gccgtgccgc ccggtgtcga ctcggtcaac       780
     atcgaccagg ccaccgagga gtggctggac aaggccggtt acatcatcgg ccgcctgcaa       840
     cgggtgatct tctacgccga gggcatcaag gagaccaact ggagcgtcac ccggccggtg       900
     ctcggcgtcg acggcgtgga gcgccgctgg gtgtacctgc actacttcaa ggacggtcag       960
     ccgtcgatca actggctcga cccgtcgttc gccgggatgc gcctcgtgat cggggacgcg      1020
     ctgcattcgc tcgccgacct gggcaccggc ggacttcgct tggacgccaa cggttttctc      1080
     ggcgcggaga agaccgccgc cgaggacagc accgcctggt cggagggtca tccgctgtcc      1140
     gaggcggcca accatctgat cgccagcatg gtgcgcaagg tgggcgggtt caccttccag      1200
     gagctcaacc tcaccatcga cgacatccgc cagatcggcg aagcgggcgc ggacctgtcc      1260
     tacgacttca tcaaccggcc cgcctaccag cacgccctgg ccaccgcgga caccgagttc      1320
     ctgcggctga cgctgcgcac cacgctggaa ctcggcgtcg acccggcgtc gttgatccac      1380
     gccctgcaga accacgacga gttgacctac gaactcgtgc actggtcgaa cggacaccgc      1440
     gacgacatct acacctacaa gggtgaggag atcaccggcg aggcgctcgg cgagacgatc      1500
     cgccgggacc tcagcgtacg gctcaccggc gagaacgccc cgtacaacct ggttttcacc      1560
     accaacggga tcgcctgcac caccgcgacg gtcatcgcgg ccaccctcgg catcaccgat      1620
     ctgaacgaga tcgacgacga tccggtgcgc atcgaccgca tccggcgagc ccatctgctg      1680
     ctggcgatgt tcaacgcgct gcagccgggg gtgttcgcgc tgtcggggtg ggacctgtgc      1740
     ggcatgctca cgttgccggc cgggcaggtc ggcgaactcc tgcgcggcgg cgacacccgg      1800
     tggatccacc gggccgccca cgatctgatg ggcgtgaatc ccgctgcgac acagtcgttg      1860
     gcggggatgc cgcgggggcg gagcctctac gggtcgatcc ccgatcagct cgacgacgag      1920
     accagcttcc tacgccagtt gcaggcgatc ctgcgggtgc gttcgcacta cggcatcgcg      1980
     acgagccgcc aggtcgacat ccccgaggtc tcccaccgcg gcatgctcgt gctggtgcac      2040
     caactggcgg acgagggccg ctatcagttg accgtgctga acttcgccaa cgaggaggtc      2100
     gccggaacgg tgcgctccga ggcgctgccg cccggcgccg aggtgtcgga catgttcacc      2160
     ggccacgcct tcgccacggt cgacgacctg cacagcttca ccgtcgagat gcccgcgcat      2220
     cacgggatgt ccctgctggt cgaggtcacc gccgacgact ccgagacgtg a               2271
//

If you have problems or comments...

PBIL Back to PBIL home page