(data stored in ACNUC30630 zone)

EMBL: CP000580.PE343

CP000580.PE343       Location/Qualifiers
FT   CDS_pept        381183..382097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0343"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mmc:Mmcs_0354
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96156"
FT                   /protein_id="ABN96156.1"
FT                   /translation="MATAHSRTRDEVRLGADQLAALAAVIEFGSFDAAAEHLHVTPSAV
FT                   SQRIKALEQRVGQVLVVREKPCRATASGIPLLRLAAQTALLEAEALGELGGPGAALVPR
FT                   VAVAVNADSMATWFTAVLGDVSEVLFDIRIEDQDHSARLLREGVVMGAVTTERSPVPGC
FT                   RVQSLGVMRYLSVASAGYVERYLPDGFTAVAAAHAPSLAWNRDDALQDMLIRRAFRRAI
FT                   TRPVHYVPTAEGFGAAVRAGLGWGMYPEQLAVPELVGGSFVRVADVHLDVPLYWQCWKL
FT                   DSPLVARLTGAVRSAAAGLARRR"
     gtggccacag cccattcgcg gacgcgtgac gaggtccgcc tcggcgccga ccaactggcc        60
     gccctcgcgg cggtgatcga attcggcagc ttcgacgcgg ccgccgagca cctgcatgtg       120
     accccgtccg cggtgagcca acgcatcaag gcgctcgaac agcgggtcgg acaggttctg       180
     gtggtgcgcg aaaagccctg tcgggcaaca gcatcgggca taccactgct gcgcctcgcg       240
     gcgcagaccg cgctgctcga ggccgaagcg ctcggggagc tcggcggtcc gggcgccgcc       300
     ctggtgccgc gggtggcggt ggccgtcaac gcggactcca tggccacgtg gttcaccgcc       360
     gtgctgggcg acgtctcgga ggtgttgttc gacatccgga tcgaggatca ggatcactcc       420
     gcccggctgc tgcgcgaagg cgtggtgatg ggggcggtca ccaccgagcg cagcccggtg       480
     cccggctgcc gggtgcagtc cctcggggtg atgcggtacc tgtccgtggc gagcgcgggg       540
     tacgtcgagc ggtatctgcc cgacggtttc accgcggtcg ccgccgcgca cgcgccgtcg       600
     ctggcctgga atcgcgatga tgcgttacag gacatgctga tccgccgggc atttcgccgc       660
     gcgatcaccc ggccggtgca ctacgtgccc accgcggagg ggttcggcgc ggcggtgcgc       720
     gccgggctgg gctgggggat gtacccggag caactggccg tccccgaact ggtcggtggt       780
     tcgttcgtcc gggtcgccga cgtgcatctc gacgtgccgt tgtactggca gtgctggaaa       840
     ctcgacagcc cgctggtggc gcgactgacc ggcgcggtcc gatccgcggc ggccggtctg       900
     gcgcggcggc gatga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page