(data stored in ACNUC30630 zone)

EMBL: CP000580.PE347

CP000580.PE347       Location/Qualifiers
FT   CDS_pept        385222..385872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96160"
FT                   /protein_id="ABN96160.1"
FT                   /translation="MAPHSFDAPVRRWEDIPGWFGWRQAQEEAVAHFGDGDRFSAPRFV
FT                   APRFVEVGSYLGRSLCSLAEVVRQSGREIGIVGVDTCRGSGPEGAREINAHGPAVEFGG
FT                   GTFAGLLHRNVIACGFADTVALLITDSVSAARMFDDESLAWVHIDARHDYESVRADIAA
FT                   WAPKVGPGGWLSGDDYHPEWWPGVVAAVEEALPDAREWTPGQWRWRKPPASDR"
     atggcgccac actccttcga cgcaccggtc cgacggtggg aggacatccc gggctggttc        60
     ggctggcggc aggcccagga ggaagccgtc gcccacttcg gcgacggcga ccggttctcc       120
     gccccacgtt ttgtcgcccc ccgtttcgtc gaggtgggca gctatctcgg ccgcagcctc       180
     tgctcgctcg ccgaggtcgt gcggcagtca ggccgcgaga tcggcatcgt cggggtggac       240
     acgtgccggg ggagcggtcc ggagggtgcc cgcgagatca acgcccacgg tccggccgtc       300
     gagttcggcg gcggcacgtt cgcgggactg ctgcaccgca acgtcatcgc ctgcggattc       360
     gccgacaccg tcgcgctcct gatcaccgac tcggtgtcgg cggcccggat gttcgacgac       420
     gaatccctgg cctgggtgca catcgatgcc agacacgatt acgagagcgt gcgcgccgac       480
     atcgcggcct gggcgcccaa ggtgggcccc ggcggctggc tgtcggggga cgactaccac       540
     ccggaatggt ggccgggtgt ggtcgctgcg gtagaagaag cactgcccga cgcccgtgaa       600
     tggacgccgg gacagtggcg ctggcggaaa ccgccggctt cggatcggtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page