(data stored in ACNUC30630 zone)

EMBL: CP000580.PE349

CP000580.PE349       Location/Qualifiers
FT   CDS_pept        complement(386581..387885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0349"
FT                   /product="DNA primase, small subunit"
FT                   /note="PFAM: DNA primase, small subunit; KEGG:
FT                   mmc:Mmcs_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96162"
FT                   /protein_id="ABN96162.1"
FT                   /translation="MADMAGSRAQGLTLDIAGRTLTVTHPDKVVFETHQGRPPISKLDL
FT                   IEYYLAVADGALRGVADRPMILKRFVKGITEEAVFQKRAPAKRPDYVDVAELKYASGTS
FT                   AKEAVIHDAAGLAWAVNIGCVDLNPHPTRSGDLAHPDELRVDLDPMPGVDWQQIVAVAM
FT                   VAREVLEDHGLTAWPKTSGSRGFHIYARIEPRWPFKFVRLAAQTIAREVERRAPDLATS
FT                   RWWKEEREGVFVDFNQNAFDRTVASAYSVRATPDARVSTPLRWDEVPGCRPEAFTVATV
FT                   PARYAEIGDPWESMDDHPGRLDALLDLADRLGPAEKAPRGAKRQGAGATGRRQSVMPLI
FT                   EIARTKTKDEALAALDTWRQRHPAAAERLQPPDVLVDGMRGPSSIWYRIRINLRHVPEE
FT                   QRPPQEPLLADYSPWGNYTGPQWASQSRHGPDTDR"
     atggctgaca tggccggatc ccgggctcag ggcctgacgc tggacatcgc cggtcgcacg        60
     ctgaccgtta cccaccccga caaggtcgtc ttcgagacgc accagggcag gccgccgatc       120
     agcaaactgg acctgatcga gtactacctc gccgtggccg acggcgccct gcgcggcgtc       180
     gcggaccggc cgatgatcct caaacgcttc gtcaagggca tcaccgagga ggcggtgttc       240
     cagaagcgcg caccggccaa gcgccccgac tacgtcgacg tcgcggaact gaagtacgcc       300
     tcgggcacct cggcgaagga ggcggtgatc cacgacgccg cggggctggc gtgggcggtc       360
     aacatcggat gcgtcgacct caacccccat ccgacgcgtt cgggcgatct cgcccatccg       420
     gacgaactgc gggtcgacct cgacccgatg ccgggtgtcg actggcagca gatagtcgcc       480
     gtcgcgatgg tggcccgaga agtgctcgag gaccacggcc tgaccgcctg gccgaagacc       540
     tcgggttcgc gcggcttcca catctatgcc cgcatcgaac cgcgctggcc gttcaaattc       600
     gtccggctgg ccgcccagac gatcgcccgc gaggtggagc ggcgcgcgcc ggacctcgcg       660
     accagccggt ggtggaagga ggaacgcgaa ggggtgttcg tggacttcaa ccagaacgcc       720
     ttcgaccgca ccgtcgcgtc ggcgtactcg gtgcgcgcca ccccggacgc ccgggtgtcc       780
     accccgctgc gctgggacga ggtgccgggc tgccggcccg aggcgttcac cgtcgcgacc       840
     gtgcccgccc gttacgccga gatcggcgat ccgtgggagt cgatggacga ccaccccggc       900
     cggctggacg cgctgctcga tctcgccgac cgactggggc cggccgagaa ggcgccccgc       960
     ggcgccaaac ggcagggcgc tggagccaca ggccgcaggc agtcggtgat gccgctcatc      1020
     gagatcgccc gcaccaagac caaggacgag gcactggccg cactcgacac ctggcgtcag      1080
     cgccacccgg ccgcggcgga acggctgcaa ccgcccgacg tcctcgtcga cgggatgcgc      1140
     ggtcccagtt ccatctggta ccggatccgg atcaacctcc ggcacgtccc ggaggagcag      1200
     cgtccgccgc aggaaccgct gctggccgat tacagtccgt ggggaaacta caccggaccc      1260
     cagtgggcct cccagtcgcg gcacggcccg gataccgacc ggtaa                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page