(data stored in ACNUC30630 zone)

EMBL: CP000580.PE365

CP000580.PE365       Location/Qualifiers
FT   CDS_pept        407195..407482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96178"
FT                   /protein_id="ABN96178.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMSSYAGAMHAVGADIASEQAALAGAWQG
FT                   DTGMTYQAWQAQWNASLEELVRAYRAMASTHEMNTMSMSARDQAEGAKWG"
     atgtcgcaga tcatgtacaa ctacccggcg atgctggcgc acgcgggtga gatgtcgagc        60
     tacgcaggcg cgatgcatgc cgtcggcgcc gacatcgcca gtgagcaggc ggcgctggcc       120
     ggtgcctggc agggtgacac cggtatgacc taccaggcct ggcaggccca gtggaacgcc       180
     agcctcgagg aactggtgcg cgcctaccgc gcgatggcga gcacccacga gatgaacacc       240
     atgtcgatga gcgcacgcga tcaggccgag ggcgccaagt ggggctga                    288
//

If you have problems or comments...

PBIL Back to PBIL home page