(data stored in ACNUC30630 zone)

EMBL: CP000580.PE373

CP000580.PE373       Location/Qualifiers
FT   CDS_pept        complement(415547..416743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96186"
FT                   /protein_id="ABN96186.1"
FT                   /translation="MTQSADPVDPPVPVLDIPGADAGARGLPRQADLTLRQRMIVDSSA
FT                   VADIALRTGVASMVGAAMLPSVVASALRPSTTGADAEHLRFYGELAAAKDPEVSFPAPT
FT                   VPPRISSRPANPVAEWTAHGRVHNIRFRSSFEAVNPALRDRCHGYRRNNVVHAQHWRHE
FT                   DGPRPTLCVIHGFMGSAYLFNGQFLSLPWFYRSGYDVLLYTLPFHGRRAEKYSPYSGYG
FT                   YFANGFAGFAEAMAQAVHDFRSLIDHLEFTGVDRVAVTGISLGGFTSALLACVDDRIQA
FT                   VIPNVPVVTPDRTVDEWFPANKLVALNRRIAGLDPELEAAASRYPSPLNYAPLVPRDRR
FT                   LIITGLGDRLAPPQQAELLWEHWERCAFHWFPGNHLLHVSQPDYLRRMTRFLRDFMFD"
     atgacgcagt ccgccgatcc cgtcgacccg cccgtccccg tgctggacat ccccggtgcc        60
     gacgccggtg cgcgcggtct gccgcggcag gccgacctca cgctgcgcca acgcatgatc       120
     gtcgactcgt cggccgtcgc ggacatcgcg ttgcgcaccg gcgtcgcctc gatggtcggt       180
     gctgccatgc tgccgtcggt cgtggcctcg gcgctgcggc cgtcgaccac cggggccgac       240
     gccgaacacc tgaggttcta cggcgaactc gccgccgcga aggaccctga ggtgtccttc       300
     ccggcgccga ccgtgccgcc ccgcatctcg tcgcgcccgg ccaacccggt cgccgagtgg       360
     accgcgcacg gccgtgtgca caacatccgg ttccgcagca gtttcgaagc ggtcaacccg       420
     gcactgcgcg accgctgcca cggataccga cgcaacaacg tcgtacacgc ccagcactgg       480
     cgccacgagg acggaccccg cccgacgctg tgcgtcatcc acggcttcat gggctcggcc       540
     tacctgttca acggccagtt cctgtcgctg ccgtggttct accgctccgg ttacgacgtc       600
     ctgctctaca cgctgccgtt ccacggccgc cgcgccgaga agtactcgcc ctacagcgga       660
     tacggctact tcgccaacgg gttcgccggc ttcgcggagg ccatggccca ggccgtccac       720
     gacttccgtt ccctcatcga ccatctcgag ttcaccggtg tcgaccgggt cgccgtcacc       780
     ggaatctcgt tgggagggtt cacctcggcg ttgctcgcct gcgtcgatga caggatccag       840
     gcggtcatcc cgaacgtgcc cgtggtcacc ccggaccgca cggtcgacga gtggttcccc       900
     gccaacaaac tggtggcgct caaccgcagg atcgccgggc tggacccgga actggaggcc       960
     gccgcatcgc gttacccgtc cccgctgaac tacgcaccgc tggtgccgcg ggaccgccgg      1020
     ttgatcatca ccggcctcgg ggaccggttg gcgccgccgc aacaggccga actgttgtgg      1080
     gagcactggg agcggtgcgc cttccactgg ttcccgggta accacctgct gcacgtcagc      1140
     cagcccgact atctgcgccg catgacacgc ttcctgcgcg acttcatgtt cgactga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page