(data stored in ACNUC30630 zone)

EMBL: CP000580.PE379

CP000580.PE379       Location/Qualifiers
FT   CDS_pept        422764..423186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0379"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0391 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96192"
FT                   /protein_id="ABN96192.1"
FT                   /translation="MDEFSAEVVAFLSEGTRTGKLGYVASDGRPLVAPVWFIVEGNQLV
FT                   FNTDRDTAKGRALRRDPRVVLCVDDERPPFSFVQVQGLASTSEDPDGLLDTATRIGGRY
FT                   MGADRAEEFGRRNGVPGELVVRITPTKVVAVFDLAD"
     atggacgagt tctccgccga agtggtcgca ttcctgtccg agggcactcg aaccggcaag        60
     ctgggctatg tcgcatcaga cggcagaccg ctcgtcgcgc cggtgtggtt catcgtcgag       120
     ggcaaccagc tggtcttcaa caccgaccgc gacaccgcga aggggcgtgc gttgcggcgc       180
     gatccccggg tggtcctctg tgtcgacgat gaacgtccgc cgttctcgtt cgtccaggtg       240
     cagggcctcg cctcgacgag tgaggatccc gacgggctcc tcgacacggc gacccggatc       300
     ggcggccggt acatgggcgc agaccgcgcg gaggagttcg gccgccgcaa cggtgtaccg       360
     ggcgagttgg tcgtccgcat cactccgacg aaggtggtcg cggtgttcga cctcgccgac       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page