(data stored in ACNUC30630 zone)

EMBL: CP000580.PE387

CP000580.PE387       Location/Qualifiers
FT   CDS_pept        428582..429295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0387"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96200"
FT                   /protein_id="ABN96200.1"
FT                   /translation="MAVVAGPGRFEEAASAALGLALLTLWVGRRRGVPVHALEAFGVAF
FT                   FAVLAVLGLIAPPDTIRWLELWAGELSNVALAVFAVATLLIRRPFTLAYAKDTAPQEYW
FT                   DSPVFLRINYVISAVWAGAFLVSAAAGAYADGVLGDNDNFWFSWIVPLAAIIFAGAFTD
FT                   YYPDRATGESTDSWARVFDWLPIFVVITGIVGWVSDSTSDTVGIALIVIGSVGSAVMRK
FT                   VFPDEPAKIPGPSQS"
     atggcggtcg tggccggtcc cggccggttc gaggaagccg cctccgccgc tctgggcctc        60
     gcgctgctga cgctgtgggt cggcaggcgc cgcggggttc cggtgcacgc actcgaggcg       120
     ttcggcgtcg ccttcttcgc ggtgctggcc gtcctcgggc tgatcgcccc gccggacacc       180
     atccggtggc tggaactgtg ggccggcgaa ttgagcaacg tcgcactggc ggtcttcgcg       240
     gtggccacgc tgctgatccg gcgcccgttc accttggcgt acgcgaaaga cactgcacca       300
     caggagtact gggacagccc ggtcttcctc cggatcaact acgtcatctc ggcggtgtgg       360
     gcgggtgcct tcctggtgtc ggcggccgca ggcgcgtacg cggacggggt gctgggcgac       420
     aacgacaact tctggttctc ctggatcgtg ccgctggccg cgatcatctt cgccggggcc       480
     ttcaccgact actacccgga ccgcgcgacg ggcgagagca cggactcctg ggcgcgggtg       540
     ttcgactggt tgccgatttt cgtcgtcatc accggcatcg tcggctgggt gtcggattcg       600
     acctccgaca cggtcggcat cgcgctgatc gtcatcggca gcgtcgggtc ggcggtgatg       660
     cgcaaggttt ttcccgacga gccggcgaag atccccgggc cgtcacagtc atag             714
//

If you have problems or comments...

PBIL Back to PBIL home page