(data stored in ACNUC30630 zone)

EMBL: CP000580.PE389

CP000580.PE389       Location/Qualifiers
FT   CDS_pept        430896..432680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0389"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0401 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96202"
FT                   /protein_id="ABN96202.1"
FT                   /translation="MSDPLGLSIGTTNLVAARVGNPPVIRRSTLSLFSDRTPQVGLPAE
FT                   QSGGVVLDGFVERVGDPVPLVAADGTSYRAEALLVEALDAMTEAVGAAPSGDIAIAVPA
FT                   HWGTATVYALRNALRTNPVFTSNGAPARLVSDAVASLTALRANPGLPTDGVVALLDFGG
FT                   SGTSITLADAAAGFAPVDETTRFTEFSGDLIDQALLTHVLTGITDAGGVDPAGTAAVGS
FT                   LTRLRERCRDAKERLSAVTAADVAAELPGYHSTIRITRAELEEMLQRPLAGVLAALDAA
FT                   LERTRIGWAGVSAVVTIGGGASIPLITQQLSAHTRVPVITTRQPALDAAVGAALFAAYS
FT                   AAAEAPTGMAAAAPVTAMIDDAPGSATFRALAWSQDDTTSDEPVPYTGDDAYEPYNPFG
FT                   PAPTGARPEVQYLPADEPEDGRRGWHVPQLAFGAAAVVAAIAVGGVAYALTSTSADSTP
FT                   VTEFETTRLPAGAPLPEPSSAPPPPVVTVTTAPPAPAPPPEPGTPLPPPPPVTPVTTTP
FT                   TTTTTTTTTTTTTTTTTTTTTTQPTTTTTQPTTTQPTTTQPTTTQPPVTTTTQPPVTTT
FT                   YVTVPFVPIPIPIQVPNN"
     atgagcgacc cgttgggctt gtcgatcggg accaccaacc tggttgcggc acgagtcggc        60
     aatccacctg tcatacggcg ttcgacgctg agcctgttca gcgatcgcac gccgcaggtc       120
     gggctgcccg ccgaacagtc cgggggcgtg gtgctcgacg gtttcgtcga gcgggtcggc       180
     gaccccgtcc cactcgtcgc cgccgacggc acctcctacc gcgctgaagc cctgctcgtc       240
     gaggcgctcg acgcgatgac cgaggccgtc ggcgcggcac ccagcggtga catcgccatc       300
     gccgtgcccg cgcactgggg taccgccacg gtctacgcgt tgcgcaacgc gctgcgcacc       360
     aaccccgtct tcacatccaa cggcgccccc gcgcgcctgg tgtccgatgc ggtcgcctcg       420
     ctgaccgcgc tgcgcgccaa ccccggactg cccaccgacg gagtcgtggc gctgctcgac       480
     ttcggtggca gcggcaccag catcaccctc gcggacgccg ccgcgggttt cgcgccggtc       540
     gacgagacca cccggttcac cgagttctcc ggtgacctga tcgatcaggc gttgctcacc       600
     cacgtactga ccgggatcac cgacgccggt ggcgtcgacc ccgcgggtac cgcggcggtc       660
     ggatcactga cccggctgcg ggaacggtgc cgcgacgcca aggaacggct gtcggcggtg       720
     acggccgccg acgtggccgc cgaactgccc ggctaccact cgacgatccg gatcacccgc       780
     gccgaactcg aggagatgct gcaacgcccg ctggccgggg tgctggccgc gctcgacgcc       840
     gcgctggaac ggacccgcat cggatgggcg ggtgtctcgg cagtcgtcac catcggcggc       900
     ggagcgagca tcccgctgat cacccaacaa ctctcggcgc acacccgtgt ccccgtgatc       960
     accacgcggc aaccggcgct cgacgccgcg gtcggtgccg ccctgttcgc cgcctacagc      1020
     gcggccgcgg aggcgccgac ggggatggcc gccgccgcac ccgtcaccgc gatgatcgac      1080
     gacgccccgg gttcggcgac cttccgcgca ctggcctggt cgcaggacga cacgacgtcg      1140
     gacgaacccg tgccctacac cggtgacgac gcctacgagc cgtacaaccc gttcggaccc      1200
     gcgcccaccg gtgcccggcc ggaggtgcag tacctgcccg ccgacgaacc ggaggacggg      1260
     cggcgcggct ggcacgtgcc gcagttggcg ttcggcgccg cggcggtggt cgcggcgatc      1320
     gccgtcggcg gtgtcgccta cgcgttgacc tcgacgtcgg ccgacagcac accggtcacc      1380
     gagttcgaga ccacccggct gcccgccggc gcgcccctgc ccgagccgtc gagtgcgccg      1440
     ccgcccccgg tcgtcaccgt caccacggcg ccgcccgcgc ccgctccgcc acccgagccc      1500
     ggcacgcccc tgcccccgcc accacccgtg acgccggtga ccacgacgcc gaccaccacc      1560
     accacaacga cgaccaccac gacgacgacc acgacaacca caaccaccac gacgacgcag      1620
     ccgaccacga cgacgacgca gccgacgacc acacagccga ccacgaccca gccgacgacc      1680
     acacagccgc cggtgaccac gacgacgcag ccgccggtga ccacgacgta cgtgacagtg      1740
     ccgttcgtgc cgatccccat cccgatccag gtgcccaaca actga                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page