(data stored in ACNUC30630 zone)

EMBL: CP000580.PE39

CP000580.PE39        Location/Qualifiers
FT   CDS_pept        45101..46258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95852"
FT                   /protein_id="ABN95852.1"
FT                   /translation="MTKCPRCFSVLDPNQYLWTLPPHAGGTRYRDDLASSYLGAPADSG
FT                   ALYTWARPPGYTGPPPPLSEASQALQGPAVEICLACHFILPDDWRNGHAVCIAMAGARA
FT                   TGKSLYIGVLVKQLELLCEHLGVSMQPATRATAVAYTMNYETPLYVQRGLVPPTPTVQT
FT                   QASHQREPLIYGIGVWHGVRRYLVLRDVAGEDLESGDLYTPPFRFFANADAVFFMFDPL
FT                   RIKGIRDQLHDLLPAQAFSGGDPRAVLNNVLHAVGAAQPKLAVIVSKFDALRVLRDVEG
FT                   SEWSLIMSNAGAAYLRDPSDTPQYDESDGQLLHEEVRSLLTRLHGGAIVAAVENPSTGM
FT                   RLPHRYFAVSALGAPPSGNRLHSRGIAPFRTVDPVRWVTAPYGVL"
     gtgacgaaat gcccgcggtg cttttcggtg ctggatccga accagtacct gtggacactt        60
     ccgccgcacg ccggcgggac ccgctaccgg gacgacctcg cctcgtcgta tctcggggcc       120
     ccggccgatt cgggcgcgct ctacacctgg gcccgcccac ccggctacac cggaccgccg       180
     ccaccgctgt ccgaagccag ccaggcgctc cagggtccgg ccgtggagat ctgcctggcc       240
     tgccacttca tcctccccga cgactggcgc aacggccacg ccgtgtgcat cgcgatggcg       300
     ggcgcccgcg ccacgggtaa gagcctctac atcggcgtgc tggtcaagca actcgagctg       360
     ctgtgcgaac acctcggggt gtccatgcag ccggccaccc gggcgaccgc ggtggcctac       420
     acgatgaact acgagacccc gctctacgtc cagcgcggtc tggtgccgcc gaccccgacc       480
     gtgcagaccc aggcgtccca tcaacgcgag ccgctgatct acgggatcgg cgtgtggcac       540
     ggcgtgcggc gctacctggt gttgcgtgac gtggcggggg aggatctgga gtccggcgat       600
     ctgtacaccc cgccgttccg gttcttcgcc aacgccgacg cggtgttctt catgttcgac       660
     ccgttgcgta tcaagggtat tcgtgaccag ctccacgatc tgctcccggc gcaggcgttc       720
     agcggtggcg atccgcgcgc ggtgctgaac aacgtgttgc acgccgtcgg ggccgcgcag       780
     ccgaagctcg cggtgatcgt gtcgaagttc gacgcgctgc gggtgctgcg cgacgtcgag       840
     ggctccgagt ggagcctgat catgtcgaac gcgggggcgg cgtatctgcg ggatccgtca       900
     gacaccccac agtacgacga gtccgacggc cagctgttgc acgaagaggt gcgcagcctg       960
     ctcacccggt tgcacggcgg ggccatcgtc gcggcggtgg agaacccgtc caccgggatg      1020
     cggttgcccc accgatattt cgcggtctcc gcgctcggtg cgcccccgag cgggaaccgg      1080
     ttgcactcgc gggggatcgc gccgttccgg accgtcgacc cggtgcggtg ggtgaccgca      1140
     ccctacgggg ttctgtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page