(data stored in ACNUC30630 zone)

EMBL: CP000580.PE4

CP000580.PE4         Location/Qualifiers
FT   CDS_pept        4475..5617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mmc:Mmcs_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95817"
FT                   /db_xref="GOA:A3PSE0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3PSE0"
FT                   /protein_id="ABN95817.1"
FT                   /translation="MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVASDAPLIRAGAPRAVVSTIVVNEGRELAVDLEITTGRANKARLNRSPVRS
FT                   PREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPSIAGVRADYDRVIRQRTA
FT                   LLKSAAGARYRGDRSVLETLDVWDGHLAAHGALLMAARADLVHHLAPEVEKAYQLLAPG
FT                   SRPAAIRYRTSIDAEDDVSAEYYEAALLDAMTRRRDAELERGVCLVGPHRDDLELRLGD
FT                   QMAKGYASHGESWSMALSLRLAAYELLRTDGSDPVLLLDDVFAELDAARRRALAEVAAS
FT                   AEQVLVTAAVAEDIPADWDARRIVIRMQDDDDGRVSMVES"
     ttgttcgtcc ggcatctgac gctgaccgac ttccggtcct gggcgcgcgc cgatctggag        60
     ttggagcccg gccgtaccgt cttcgtcggc cccaacggtt tcggcaagac gaatctcgtt       120
     gaggcgctgt ggtattcggc aacgctcggc tcacaccgag tggcctcgga cgccccgctc       180
     atccgggccg gcgcaccgcg cgcggtggtg tcgaccatcg tggtgaacga aggtcgcgag       240
     ttggcggtcg acctcgagat caccaccggc cgggcgaaca aggcgcggct caaccgttca       300
     ccggtgcgca gcccccgcga agtgctcggg gtgttgcgtg cggtgctgtt cgcccccgag       360
     gatttggcgc tggtacgcgg tgacccgggc gaacgccgcc gctatctcga cgaactcgcc       420
     accacccgtc gcccgagcat cgccggcgta cgcgccgact acgaccgggt catcaggcag       480
     cgcaccgcac tgttgaagag cgccgcgggg gcccggtacc gcggagaccg cagcgttctc       540
     gagaccctcg acgtgtggga tgggcacctc gccgcgcacg gtgcgttgtt gatggccgcg       600
     cgcgccgacc tcgtgcacca cttggcgccg gaggtcgaga aggcctatca actcctggcg       660
     ccggggtcgc ggccggcggc catccggtac cgcaccagca tcgatgccga agacgatgtc       720
     agcgccgagt actacgaggc cgccctgctc gacgcgatga cccgccggcg cgacgccgaa       780
     ctcgaacgcg gggtctgcct ggtcggcccg caccgggacg acctggagtt gcggctcggt       840
     gaccagatgg cgaaaggcta tgccagccat ggggagtcgt ggtcgatggc gttgtcgctg       900
     cggttggccg cctatgagct gttgcgaacc gacggcagcg atccggtcct cctgctcgat       960
     gacgtgttcg ccgaactgga cgccgcccgg cggcgcgccc tggccgaggt cgcagcgtct      1020
     gcggagcagg tgctggtcac cgcggcggtc gccgaggaca tccccgccga ctgggatgcg      1080
     cggcggatcg tgatccggat gcaggacgac gacgatgggc gcgtatcgat ggtggagtca      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page