(data stored in ACNUC30630 zone)

EMBL: CP000580.PE403

CP000580.PE403       Location/Qualifiers
FT   CDS_pept        446176..447030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0403"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96216"
FT                   /protein_id="ABN96216.1"
FT                   /translation="MSSTSRVGISSLFACALLFGSTAVTPDISQAQPGPGGATVLTLAP
FT                   AFNELKSNWLRGELFAAPNVKVKVPYTNIPSATNTHKGADKLNEMLHAYPGPKIVAGHS
FT                   QGAQVADDWLRRYGPTSDIDPATVQFVLTGDLESKYNGCANVPGSGCVAAYGGNNFPDD
FT                   TPYTVKVIARQYDYFADCPNDLSNETAKKNRNASQVVGGKGELNSVHTNYSNIGLNDPG
FT                   NKTFVEGNATYILGAPATYFLPVVTQKWTSNESKVVEDAELRPIVESAYNRPMGAPPAP
FT                   PAP"
     atgtcgtcaa cgagccgtgt tggaatttct tcactattcg cttgtgcgct cctcttcgga        60
     tctacggcgg tgacgccgga catatcgcag gcgcaacccg gaccgggcgg ggcaaccgtg       120
     cttaccctcg cgccggcgtt caacgaattg aagtccaatt ggctgcgtgg tgaattgttc       180
     gccgcaccga atgtgaaggt caaggtcccg tacacgaaca tcccgagtgc cacgaacacg       240
     cacaagggcg ccgacaaact caacgagatg ctgcacgcct atccgggccc caagatcgtg       300
     gccgggcaca gccagggtgc gcaggtggcc gacgactggc tgcgccgtta cggaccgacc       360
     agcgacatcg acccggcgac tgtgcaattc gttctgacgg gtgatctgga gagcaagtac       420
     aacgggtgcg cgaatgttcc gggcagcggt tgtgtggccg cctacggggg aaacaatttc       480
     cccgatgaca ccccgtacac ggtgaaagtg atcgcccgtc aatacgacta tttcgcggac       540
     tgccccaacg acctgtcgaa tgaaaccgcg aagaagaacc gcaatgcgtc acaggtcgtc       600
     ggcggtaagg gtgaactcaa cagcgtgcac acgaattaca gcaacatcgg tttgaacgat       660
     cccggcaaca agaccttcgt cgaggggaat gcgacgtaca tcctcggcgc accggcgacc       720
     tatttcctgc cggtggtcac gcagaagtgg acgtcgaacg aatccaaggt ggtggaggac       780
     gccgagctgc gtcccatcgt ggaatcggcc tacaaccgac cgatgggagc gccgcccgca       840
     ccaccggcac cgtga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page