(data stored in ACNUC30630 zone)

EMBL: CP000580.PE407

CP000580.PE407       Location/Qualifiers
FT   CDS_pept        complement(448972..450471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0407"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0419 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96220"
FT                   /protein_id="ABN96220.1"
FT                   /translation="MRILARSGLALLVAVGTVLLALVSTVTLVFTLAASTYVIRGTEYG
FT                   VPFCLPFCHGNPTPEELAMPYVDGTVNNPPDGIVVVDYPASFWPFSDGYFVDPTYDDAV
FT                   EQGVNALPPPGQFQDLDGSVIFGYSQGTQVATLYKREFNEYWASDPTAAPDVTFVLLGN
FT                   GSRPNGGLMSRFDGAYVPILDVSFIGPTPTTTAGATPGEITTYDIARQYDLFADFPTNP
FT                   LNILAVANAFAGQLFVHPDYGSVDMSQAVFQGTYGDTAYYLIPTYPLPLLMPLTWIPVI
FT                   GPIAVDMLDPVLRVLVEAGYDRTINPGVPTPANFLYLPDPVTLGSSLLHAIPTGLTYGT
FT                   QDILHLREPGTPPPGVAGQDAYGIGGPSVTLPNQTPPPAPAVQTVAAPSTPKVPSATPT
FT                   TAVPLSDGVNDSVIPSTSPPAPKQHIVDEPIGGSSSNGAVKRSASTADDAPADASTQSR
FT                   PKSSGTTDRPSGAGNSNGKGGSSSSSTGNSNGKGSSSSTGD"
     atgcgaattc ttgcccgctc cggcctggct cttctcgttg ccgtcggcac cgttctgttg        60
     gctctcgtct cgacggtgac cttggtgttc acgcttgcag cgtcgaccta tgtcatcagg       120
     ggaaccgagt acggcgttcc cttctgtttg ccgttctgcc acgggaatcc cacgcccgaa       180
     gagctggcga tgccctacgt cgacgggacg gtcaacaatc cgcccgacgg catcgtcgtg       240
     gtggactacc cggcgagctt ctggccgttc tccgacggtt acttcgtcga ccccacctac       300
     gacgacgcgg tcgagcaagg cgtaaacgcg ctgccgccac ccggtcagtt ccaggacttg       360
     gacggcagcg tcatcttcgg ctactcgcag ggcacccagg tcgcgacgtt gtacaagcga       420
     gaattcaacg agtactgggc gagcgacccg acagccgcgc ccgacgtcac cttcgtgctc       480
     ctcggcaacg gcagccgccc gaatggtgga ttgatgtcgc ggttcgacgg ggcctacgtt       540
     ccgatcctcg acgtttcgtt catcggtccc accccgacga ccacggcggg ggcgactccg       600
     ggcgagatca cgacctatga catcgcgcgc cagtacgacc tcttcgccga cttcccgacc       660
     aatccgctga atatcctcgc cgtcgccaac gcgttcgcgg gtcagctctt cgtgcaccct       720
     gactacggat ccgtcgacat gagccaagcc gtgttccagg gcacctacgg cgacacggcg       780
     tactacctga tcccgaccta tcctctgccg ctcctcatgc cgctgacctg gattccggtc       840
     atcggcccca ttgccgtcga catgctggat cccgtactgc gcgtcctggt ggaggctggg       900
     tacgaccgca ccatcaatcc cggtgtgccg acaccggcca acttcctcta cttgcccgac       960
     ccggtgaccc ttggttccag cctccttcac gcgataccca caggactgac atacgggacg      1020
     caggacatcc tccatctgcg cgaaccgggg acaccgccgc ccggcgtggc cgggcaggac      1080
     gcgtacggca tcggcggtcc gtcggtgacc ctgccgaatc agacgccccc gcctgcaccc      1140
     gccgtccaaa ccgtagcggc gccttcgacg ccgaaagttc cttccgccac gccgacaacg      1200
     gcggttcctc tgtctgacgg cgtgaacgat tcggtgattc cgtcgacgag cccgccggcg      1260
     ccaaagcagc acatcgtcga cgagccgatc ggcgggtcgt cttcgaacgg ggcggtcaag      1320
     aggtcggcat caacggcaga tgacgctccg gcggatgctt cgacccaatc ccgccccaag      1380
     agctcaggga ccaccgaccg cccgagcggc gccggcaatt ccaacggcaa gggcggttcc      1440
     agttccagca gcaccggaaa ttcgaacggc aagggcagtt ccagcagcac cggcgactga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page