(data stored in ACNUC30630 zone)

EMBL: CP000580.PE425

CP000580.PE425       Location/Qualifiers
FT   CDS_pept        complement(471015..471536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0426"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mmc:Mmcs_0439 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96238"
FT                   /protein_id="ABN96238.1"
FT                   /translation="MTQPTGHREVTLEVDGRPHTLHLDNRVTLLDALREHLGVTAPKKG
FT                   CDHGQCGSCTVLRDGRRVTTCLTFAVAADGAHITTAAGLGDGDDLHPVAQAFYDEDGFQ
FT                   CGYCTPGQICSAVGMLDEVKSGAPSFVSDDLEAVPELTDDEIRERMSGNLCRCAAYPNI
FT                   VAAIERAAVQ"
     atgacccagc ccaccggtca tcgtgaagtg accctcgagg tcgacggccg gccacacaca        60
     ctgcacctcg acaaccgcgt caccctgctc gacgcgctgc gtgagcacct cggcgtgacc       120
     gcacccaaga agggatgcga ccacggccag tgcggttcgt gcaccgtgct gcgcgacgga       180
     cggcgggtca ccacctgcct gacgttcgcg gtcgccgccg acggtgcgca catcaccacc       240
     gccgccggtc tcggcgacgg cgacgatctg caccccgtcg cgcaggcgtt ctacgacgag       300
     gacggcttcc agtgcgggta ctgcaccccg ggccagatct gctccgcggt cggcatgctc       360
     gacgaagtca agtccggcgc accgagtttc gtgtccgacg atctcgaggc ggtaccggaa       420
     ctgaccgacg acgagatccg ggagcggatg agcggcaacc tgtgccgctg cgcggcgtac       480
     ccgaacatcg tcgccgcgat cgaaagggcc gcggttcagt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page