(data stored in ACNUC30630 zone)

EMBL: CP000580.PE428

CP000580.PE428       Location/Qualifiers
FT   CDS_pept        complement(474289..477417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0429"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: mmc:Mmcs_0442 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96241"
FT                   /protein_id="ABN96241.1"
FT                   /translation="MDTQILIRLIVGLLMTGIVIALAAKRVLWLTKLIRSGAPTSEANN
FT                   RKDNLGKRITTQFEEVFGQTRLLRWSIPGIAHFFTMWGFFILASVYLEAYGLLFDHDFH
FT                   IPIIGTWDALGFLQDFFAVAVLLGIITFAIIRIVREPKKHGRDSRFYGSHTGGAWLILF
FT                   MIFNVIWTYALVRGAAADVGNLPYGNGAFFSQFMGWVLSPLGHDVNEWVETIALLLHIA
FT                   VMLVFLLIVLHSKHLHIGLAPINVTFKRLPNGLGPLLPMEYNGEPIDFEDPAEDAVLGR
FT                   GKIEDFTWKGYLDFTTCTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYILGD
FT                   KESPLENTPEGGLGEELRGEKESEKHSHDHVPESGFERIMGSGPEQATRPLVGTLEQGG
FT                   VIDPDVLWSCTTCGACVEQCPVDIEHIDHIVDMRRYQVMMESEFPGELGVLFKNLETKG
FT                   NPWGQNAKDRTNWIDEVDFDVPVFGKDVESFEGYEYLFWVGCAGAYEDRAKKTTKAVAE
FT                   LLAIAGVKYLVLGEGETCNGDSARRSGNEFLFQQLAAQNVETLNDLFEGVERVDRKVVV
FT                   TCPHCFNTLGREYPQVGGNYTVLHHTQLLNRLVRDKKLVPVTPADGGADITYHDPCYLG
FT                   RHNKVYEAPRELIGASGAKLTEMPRHADRGLCCGAGGARMWMEEHIGKRVNVERTEEAM
FT                   DTASTIATGCPFCRVMITDGVDDVAATRNVEKAEVLDVAQLLLGSLDKSGVTLPEKGTA
FT                   AKESEERAAVRAEEAAAAAPAPEKAPEKEPEAPAEAPAAKASTTTESKPAGATPAAAPA
FT                   KGLGIAGGAKRPGAKKTATEKTAAAPAEAKGLGLAAGAKRPGAKKTATEKTTAAPEAKA
FT                   ETAGTTEAPAEAKPEPEVKGLGLAAGAKRPGAKKTPAKASPNEGAATVVQPPNADPDKA
FT                   EAGTEAPDTADSDRGLETKPEPEVKGLGIAAGARRPGAKKKTAAPAAAPAKPAEPEAEP
FT                   QAQPEAQAEPEPEPEPEAPSQPASGNGDARVVGDEPPVKGLGIAKGARRPGKR"
     gtggacacgc agattctgat ccgactcatc gtcgggttac tgatgaccgg catcgtgatc        60
     gcactcgccg caaaacgcgt gctgtggttg acgaagctga tccggtccgg cgcgcccacc       120
     agcgaggcga acaaccgcaa ggacaacctc ggcaaacgca tcaccacgca gttcgaagag       180
     gtcttcggcc agacccgcct gctgcgctgg tcgatccccg gtatcgcgca cttcttcacg       240
     atgtggggct tcttcatcct cgcgtcggtc tacctggagg cctacggcct gctgttcgac       300
     cacgacttcc acatcccgat catcggcacg tgggacgcac tcggtttcct gcaggacttc       360
     ttcgccgttg cggtgctgct cggcatcatc accttcgcga tcatccgcat cgtccgcgag       420
     cccaagaaac acggccgcga ctcccggttc tacggttcgc acaccggcgg cgcctggctg       480
     atcctgttca tgatcttcaa cgtcatctgg acctacgcgc tggtgcgtgg cgccgccgcg       540
     gacgtcggca acctgcccta cggcaacggc gcgttcttct cccagttcat gggctgggtc       600
     ctgagcccgc tcggccacga cgtcaacgag tgggtcgaga ccatcgccct gctgctgcac       660
     atcgcggtca tgctggtctt cctgctgatc gtgctgcact ccaagcacct tcacatcggt       720
     ctggcgccca tcaacgtcac gttcaagcgg ctgcccaacg gcctcggccc gttgctgccg       780
     atggagtaca acggcgagcc gatcgacttc gaggatcccg ccgaggacgc cgtgctgggc       840
     cgcggcaaga tcgaggactt cacctggaag ggctacctcg acttcacgac gtgcaccgaa       900
     tgcggccgct gccagtcgca gtgcccggcg tggaacacgg gtaagccgct gtcgcccaag       960
     ctcgtgatca tgaacctgcg cgaccacatg ttcgccaagg ccccctacat cctcggcgac      1020
     aaggagtcgc cgctggagaa cacccccgag ggcggtctcg gcgaggaact gcgcggtgag      1080
     aaggaatccg agaagcactc ccacgaccac gtcccggagt ccggcttcga acggatcatg      1140
     ggctccggac ccgagcaggc cacccgcccg ctggtcggca ccctcgaaca gggcggcgtg      1200
     atcgaccccg acgtgctgtg gtcctgcacc acctgcggtg cctgcgtcga gcagtgcccg      1260
     gtcgacatcg agcacatcga ccacatcgtg gacatgcgcc gctaccaggt gatgatggag      1320
     tccgagttcc ccggtgaact cggtgtgctg ttcaagaacc tggagaccaa gggcaacccc      1380
     tggggccaga acgccaagga ccgcaccaac tggatcgacg aggtcgactt cgacgtgccg      1440
     gtgttcggca aggacgtcga atccttcgag ggctacgaat acctgttctg ggtcggctgc      1500
     gccggcgcct acgaggaccg cgcgaagaag accaccaagg ccgtcgccga actgctcgcg      1560
     atcgccggcg tcaagtacct ggtgctcggc gaaggtgaga cctgtaacgg cgactcggcc      1620
     cgacgctccg gtaacgagtt cctgttccag caactcgccg cacagaacgt cgagaccctc      1680
     aacgacctgt tcgaaggtgt ggagcgggtc gaccgcaagg tcgtcgtcac ctgcccgcac      1740
     tgcttcaaca ccctcggccg cgagtacccg caggtcggcg gcaactacac cgtcctgcac      1800
     cacacccagc tgctcaaccg gctggtccgc gacaagaagc tggttccggt cacccccgcc      1860
     gacggtgggg cggacatcac ctaccacgac ccctgctatc tgggccggca caacaaggtc      1920
     tacgaggcgc cccgtgagct gatcggcgca tccggcgcga agctgaccga gatgccgcgc      1980
     cacgccgacc gcggcctgtg ctgcggtgcc ggcggtgcgc ggatgtggat ggaagagcac      2040
     atcggcaagc gcgtcaacgt ggagcgcacc gaggaggcga tggacaccgc atcgacgatc      2100
     gcgaccggtt gcccgttctg ccgcgtgatg atcaccgacg gtgtcgacga cgtcgccgcc      2160
     acccgcaacg tcgagaaggc cgaggtcctc gacgtggccc agctgctgct cgggtcgctg      2220
     gacaagagcg gcgtcacgct gccggagaag ggcaccgcgg ccaaggagtc cgaggagcgc      2280
     gccgccgttc gtgctgagga ggcggcagcg gccgcaccgg ccccggagaa ggcccccgag      2340
     aaggagccgg aagcgccggc cgaagcaccc gcggccaagg cgtcgacgac caccgaatcg      2400
     aagccggccg gcgcaactcc ggctgcagct ccggcgaagg gtctcggcat cgccggtggc      2460
     gccaagcgtc ccggtgcgaa gaagaccgcc accgagaaga ccgcagcagc gcccgcggaa      2520
     gccaaggggc tgggtctcgc cgcaggcgcc aagcgtcccg gcgcgaagaa gaccgccacc      2580
     gagaagacca cagctgcacc cgaggccaag gccgagactg cgggaaccac cgaggctccc      2640
     gcggaagcca aacccgaacc cgaggtcaag gggctgggtc tggccgcagg cgccaagcgt      2700
     cccggcgcga agaagacgcc cgccaaggcg tcgccgaacg aaggcgccgc gacggtcgtc      2760
     cagccgccga acgcggaccc ggacaaggcc gaggccggca ccgaggcccc ggacaccgcc      2820
     gattcggatc ggggtctgga gaccaagccg gaacccgagg tgaaggggct cggcatcgcc      2880
     gcgggcgccc gtcgcccggg tgcgaagaag aagaccgccg caccggctgc cgcgcccgcg      2940
     aagccggccg aacccgaagc cgagccgcaa gcccagcctg aagcccaagc agaacccgaa      3000
     cccgaacccg agccggaggc accgtcgcag cccgcatcgg gcaacggcga cgcccgcgtc      3060
     gtgggtgacg agccgccggt caagggcctg ggcatcgcga agggtgcccg tcggccgggg      3120
     aagcgctga                                                              3129
//

If you have problems or comments...

PBIL Back to PBIL home page