(data stored in ACNUC30630 zone)

EMBL: CP000580.PE431

CP000580.PE431       Location/Qualifiers
FT   CDS_pept        482154..482678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96244"
FT                   /protein_id="ABN96244.1"
FT                   /translation="MANSLLDFVMSLVRDPDAAARYAADPAAAIADAQLTDVTSVDVDN
FT                   LIPVVTESMPMAAASTGLDPFGAEAAGNVWSSGAATAAFDAFADPAPASAVIDTTSAVI
FT                   DTTDHFDQAADPLTGSDTLVDSLSTQLTDPVLDEATPAGTGLDDVWGAALDDVQPADHD
FT                   PGQNPGFDLFD"
     atggctaact cactactcga cttcgtgatg tcgctggtgc gggaccccga cgctgccgca        60
     cggtacgccg ccgatcctgc cgcagccatc gcagatgcgc agctcaccga cgtgaccagc       120
     gtcgacgtcg acaacctgat ccccgtggtg acggaatcga tgccgatggc cgcggcgtcg       180
     accggcctgg accccttcgg ggcggaggcc gcgggcaatg tgtggtccag cggcgccgcc       240
     accgcggcgt tcgacgcgtt cgccgatccg gcacccgcct cggccgtcat cgacaccaca       300
     tccgccgtca tcgacacgac cgatcacttc gaccaggccg ccgacccgct caccggatcc       360
     gacaccctcg tcgactcgct gtcgacgcag ctcaccgacc cggtgctgga cgaggcgacg       420
     cctgcgggca caggcctcga cgacgtgtgg ggtgcggcgc tcgacgacgt ccagccggcc       480
     gaccacgatc ccggccaaaa cccggggttc gacctgttcg actga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page