(data stored in ACNUC30630 zone)

EMBL: CP000580.PE44

CP000580.PE44        Location/Qualifiers
FT   CDS_pept        complement(49301..49606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABN95857"
FT                   /protein_id="ABN95857.1"
FT                   /translation="MTTDKTGASTTVKAEADRFTIGVEGQTVGFAEFTDRDGQRVFTHT
FT                   EVDGEFEGRGLATILVGEALDQTRSAGKRIVPECKLVASYIDKHDEYADIVDPVGH"
     gtgaccaccg acaagaccgg cgcgtccacc accgtcaagg ccgaagccga ccgattcacc        60
     atcggcgtgg agggtcagac ggtcggcttc gcagagttca ccgatcgcga cggccagcgg       120
     gtgttcaccc acaccgaggt cgacggtgag ttcgagggcc gcggcctggc cacgatcctc       180
     gtcggggagg cgctggacca gacgcggtcc gcgggtaagc gcatcgtgcc ggagtgcaaa       240
     ctcgtcgcga gctacatcga caaacacgac gagtacgccg acatcgtcga ccccgtcggc       300
     cactga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page