(data stored in ACNUC30630 zone)

EMBL: CP000580.PE460

CP000580.PE460       Location/Qualifiers
FT   CDS_pept        512613..513545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mjls_0461"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   syf:Synpcc7942_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mjls_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABN96273"
FT                   /protein_id="ABN96273.1"
FT                   /translation="MATAVTVFHPSDGQARFAAFVDAFVESARGMAGFVAACTSLADFE
FT                   PAVAVTFADGGSLERWLDCSGHAEALRFGQELGFWRAATPMVLADDAPPPAGVAAFRHD
FT                   VADGREDEFLATQRCLGIAVADAPGYEGTALFPPDDAGRWLSVVRFRSDRRLADWLSSA
FT                   RRAEALPELRSTLVEDFSSLAQTTPFGTTVRVDDGRLRMTPNWKSAMMVMLVLYPTVML
FT                   LSRFLGPVLDGWSVQPWLALWLSQVASVVLMQWWLMPAATGLFRRWLDPVDGAGRTTTL
FT                   RGAAVVVAVYALTLALFASVAWLQYWDHP"
     atggctaccg ccgtcaccgt gttccatccg tccgatggcc aggcccggtt cgccgcgttc        60
     gtcgacgcgt tcgtcgagtc agcccgaggc atggcgggtt tcgtcgccgc ctgcacctcg       120
     ttggccgact tcgagcctgc ggtcgcggtg acgttcgccg acggcgggtc gctcgaacgc       180
     tggctcgact gctccggcca cgcagaggcg ctgcggttcg ggcaggaact cgggttctgg       240
     cgggccgcaa cgccgatggt gctcgccgac gatgcgccac cgccggctgg tgtcgccgcg       300
     ttccgtcacg atgtggccga cggaagggag gacgagttcc tggccacgca acgctgtctc       360
     ggcatcgcgg tggccgatgc cccgggttac gagggcaccg cgctgttccc gccggacgat       420
     gcgggtcggt ggctctcggt ggtgcggttt cgctccgaca gacggctggc ggactggctg       480
     tcgtcggcgc gccgagccga ggcgttaccc gagttgagaa gcactctcgt cgaggacttt       540
     tcgtcgctgg cgcagaccac cccgttcggc accacggtgc gcgttgacga cggccggctg       600
     cgtatgacgc cgaactggaa gtcggccatg atggtgatgc tcgtgctcta cccgacggtg       660
     atgctgctgt cgcggttcct cggtccggta cttgacggct ggagtgtgca gccgtggctt       720
     gcgctgtggc tgagccaggt ggccagcgtc gtgctcatgc agtggtggct gatgcccgcc       780
     gcgacggggc tgttccgccg gtggcttgat cccgtcgacg gtgcgggccg aacgacgacg       840
     ctgcgcggtg cggcggtcgt ggtggcggtc tacgcgctca cgctggccct gttcgcttcg       900
     gtcgcgtggc tgcagtactg ggaccacccc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page